KEGG   Lodderomyces elongisporus: LELG_04974Help
Entry
LELG_04974        CDS       T01116                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lel  Lodderomyces elongisporus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LELG_04974
Enzymes [BR:lel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LELG_04974
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LELG_04974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 688 aa AA seqDB search
MSDNSELIKGVIDLDPWLKPFSQQLIKRQLQFREWDEKLEKSEGSLLKFADAYHRYGLNP
TNHGNGGAEIIEYIPDVDEVSLVGEFNNWDKTSHKLQKLNDFGLWGLKIDGKDTIPHDSP
YKIAMKLGKTGEWIYRLDPWVKRATYNKSNNLYEGRFWNPPPNEVYHLKNKRPKQTQGIK
VYEAHVGISTPEPKIGTYKNFTTNILPKIKELGYNTIQLMAVMEHAYYASFGYQITSFFA
ISSRYGTPEELKELIDTAHGYGIRVLLDVVHSHSSKNVEDGLNMFNGTDHYLFHGGTKGQ
HELWDSRLFNYTNYETLRFLLSNLKFYIDVYGFDGFRFDGVTSMLYKHHGLSFGFSGDYN
EYFNEDWVDNEAIVYLMLAHKLMDDISKKEGIEITSIAEDVLGMPTLCRPISEGGIGFDY
RLSMAIPDMWIKILKHLQDEQWDLGNIVHTLTNRRHGEKCIAYCESHDQALVGDKTLAFW
LMDKEMYTNMSKLSELTPVVDRGLALHKMIRLITFALGGEGYLNFEGNEFGHPEWLDFPR
AGNGESYHYARRQFNLIEDDLLRYKFLYDFDAAMQHLDVLDSPQAYISLKNESDKVVVFE
RNELLFIFNFNATQSFPDYKVGVDIPGTYEIILNSDDAKFGGHARIEDVDAQGKKQQFFT
NDDGWNHRRNSLMVYIPSRTALVLQRVK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaactcagaacttatcaaaggggtaattgaccttgacccctggttaaagcca
ttctcacaacaattgatcaaacgacaattgcaattccgtgaatgggacgagaaattggaa
aaaagcgaaggctctctacttaaatttgctgacgcctaccacagatacggattaaaccca
actaaccacggcaatggcggtgctgagatcattgagtatatccccgacgttgatgaagta
agtcttgttggagaattcaacaattgggacaagacaagccacaagttgcaaaaactaaac
gactttggactttggggattaaaaattgatggcaaagacacaattcctcacgactcgcct
tacaagattgccatgaaacttggcaaaaccggagaatggatatacagattagacccatgg
gtgaaacgcgctacttacaacaagtcaaacaatttgtacgaaggtaggttctggaatcct
ccaccaaatgaagtataccatttaaaaaacaaacgcccaaaacaaacccaaggaataaaa
gtctatgaagcccacgttggtatctcgactcccgaacccaagattggtacatacaaaaac
tttaccaccaatatcttaccaaaaattaaagagttgggatacaacacaatccaattaatg
gcagttatggaacacgcatactatgcttcgtttggataccaaatcaccagcttttttgca
attagctcacgctacggaacacccgaagaattaaaagagttgattgacactgcacacgga
tacggaatccgtgtcttgctcgacgttgtccactcgcattcatcaaagaatgtcgaagat
ggtctcaatatgttcaatggcaccgaccattacctattccatggcggcactaaaggacaa
cacgagttgtgggattcaagattattcaactataccaattacgaaacattgcgcttcctc
ttgtccaacttgaaattctatatcgacgtttatggatttgacggctttagatttgatggt
gtcacatcaatgctctacaaacaccatggcctcagttttggatttagcggcgattacaat
gagtatttcaacgaagattgggtcgacaatgaagcaatagtttacctcatgctcgcccat
aaattaatggacgacattagcaaaaaagaaggtattgaaatcacatccatcgccgaggat
gtgctgggaatgcccaccttgtgtcgccccatcagcgagggtggtattgggtttgactat
agactttcaatggctatcccagatatgtggatcaagattcttaaacatttgcaagatgaa
caatgggacttgggtaatattgtccacacattaaccaatcgtcgtcatggcgaaaagtgt
atcgcatattgtgaatcgcatgaccaagcacttgttggtgacaagaccttggcattttgg
ttgatggataaagaaatgtataccaacatgtccaagcttagtgaacttacccccgtggta
gacagaggcttggccctacacaaaatgattagactcatcacctttgcattgggtggtgag
gggtacctcaatttcgaaggtaacgagtttggccatccagaatggctcgatttcccacgt
gccggtaacggggaatcgtatcattacgcaagaagacaattcaaccttattgaggatgac
ttgcttcgttacaaatttttatacgatttcgatgcagcaatgcaacatctcgatgtgctt
gactcgcctcaagcatatatctcactcaagaatgagtcagataaagttgttgtatttgaa
agaaacgaactcttgtttatctttaatttcaacgcaacccagtcattcccagactacaaa
gtcggtgttgatattcctggtacttatgagattatactcaactcggatgatgctaaattt
ggtggccatgcaagaattgaggatgtagatgcacagggcaaaaagcaacaatttttcaca
aatgatgatggatggaaccatagacgcaactcattgatggtgtatattccatcaagaact
gcattggtgttgcaaagagttaaataa

DBGET integrated database retrieval system