KEGG   Lodderomyces elongisporus: LELG_05020Help
Entry
LELG_05020        CDS       T01116                                 

Definition
similar to dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_05020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_05020
   00020 Citrate cycle (TCA cycle)
    LELG_05020
   00620 Pyruvate metabolism
    LELG_05020
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LELG_05020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MSAIFAASAKNAVRSLASFNAATIRLTSASRTSGLTLARLYSSGKFPPHTVIHMPALSPT
MTQGNIQSWAKSVGDELSPGEPIAEIETDKASMDFEFQEEGYLAKILMDAGSKDVPVGQP
IAVYVEESGDVSAFKDFTAADAGEGPKQAAPAAEEEKAESKKSEEPKEQKDASSSPSSSP
AKKTSPPVDRIFASPYAKTIALEKGISLKGVKGSGPHGRIVAKDLEGLEPSSASSASSAP
AAAAASTPAASATYEDIPLTNMRKTIATRLLQSTQQSPTYIIQSQISVSKLLKLRASLNA
SAEDRYKLSVNDLLVKAIAVASQRVPQVNAAWLGEQGVIRQYSNVDVSVAVATPTGLITP
IVKDAHSKRLSAISNEIKDLGKRAKAGKLNPEEYQGGTICISNLGMNHAVTAFTSIINPP
QSAIVAIGTTEKKAVPSEVNEQGFVFDDVMTITGTFDHRVADGAVGGEWIKELKRVIENP
LEMLV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctatctttgctgcttctgccaagaatgcggtgcgttcattggcctcattcaac
gccgccaccatcagattaacatcggcatcaagaacctccggcttgaccttggccagatta
tactcttctggtaagtttcctccacacaccgtcatccacatgcctgcattgtctccaaca
atgacacagggtaacatccaaagctgggccaagtccgtcggtgatgaattgagccctggt
gagccaattgcagaaattgaaaccgataaagcttccatggactttgagtttcaagaagaa
ggttacttggctaaaattttgatggatgctggctccaaggatgttcctgttggtcaacca
attgccgtctacgttgaagagtctggtgatgtttctgctttcaaagactttactgctgct
gatgcaggagaaggaccaaaacaagcggctcctgcagctgaagaagagaaagccgaatca
aagaagagcgaagaaccaaaagaacaaaaagacgcttcttcttcaccatcatcatctcca
gcaaaaaagacctctccaccagtagacagaatctttgcttctccatacgccaagaccatt
gcattggagaaaggtatctcattgaaaggtgtcaagggttcaggaccacatggtagaatt
gttgccaaggaccttgaaggcctcgagccatcaagcgcttcttcagcatcttcagcacct
gctgctgctgctgcttctactccagcagcttctgctacatacgaggatatcccactcacc
aacatgagaaagactattgccactagactcttgcaatcaactcaacaatcacctacctac
atcatccaatcacaaatctctgtttccaaattgttgaagttgcgtgcttcccttaatgct
tccgccgaggacagatacaagctttccgttaatgatcttttggtcaaggctattgctgtt
gcttcacaaagagtaccacaagtcaacgctgcttggttgggtgaacaaggtgttatcaga
caatactcaaacgttgatgtatccgttgccgttgccacaccaaccggtttgattactcca
attgttaaggatgcgcacagcaagagactttcagccatttcaaacgaaattaaagacttg
ggaaagagagccaaggctggtaaattgaaccctgaagaatatcaaggtggtacaatctgt
atctccaacttgggtatgaaccatgctgtcactgcattcacctccatcatcaacccacca
caatctgccattgttgctattggtactacagagaagaaggcagtcccaagcgaagttaac
gagcaaggttttgtctttgatgacgtcatgaccatcaccggtacctttgaccacagagtc
gctgacggtgccgtcggtggtgaatggatcaaggagttgaagagagttatcgagaaccca
ttggaaatgttggtttaa

DBGET integrated database retrieval system