KEGG   Lodderomyces elongisporus: LELG_05055Help
Entry
LELG_05055        CDS       T01116                                 

Definition
6-phosphofructokinase beta subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_05055
   01230 Biosynthesis of amino acids
    LELG_05055
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_05055
   00030 Pentose phosphate pathway
    LELG_05055
   00051 Fructose and mannose metabolism
    LELG_05055
   00052 Galactose metabolism
    LELG_05055
  Energy metabolism
   00680 Methane metabolism
    LELG_05055
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LELG_05055
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LELG_05055
Protein phosphatases and associated proteins [BR:lel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LELG_05055
Messenger RNA biogenesis [BR:lel03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LELG_05055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 754 aa AA seqDB search
MRTGMNAAVRAVVRAAVFRGCKAFAIKEGYEGLVRGGEKYITEMKWQDVRGFLSDGGTNI
GTARCMEFKEREGRLKGCRHLIEAGIDGLIVCGGDGSLTGADLFRSEWPSLISELRERKE
ITEEQYERHKHLYICGMVGSIDNDMATTDSTIGCYSALERICRAVDYIDATANSHSRAFV
VEVMGRHCGWLALMAGIATSADYILIPEKPASSHDWQDQMTTIVKNHRAAGKRKTIVIVA
EGAITIDLKPISSEDVKDVLVDRLGLDTRITTLGHVQRGGSAVSFDRILATLQGVEAVKA
VLDLTPDTPSPLIAIDENQVVRRPLVEAVKITKSVAQAIAERDFEKAMSLRDSEFKEHLA
NFMAMNSACHDKPVLPVEKRKKIAIINIGAPAGGMNSATYAMATYCMSQGHTPYAIHNGF
AGLSRHESVKSIEWIDIEGWNSVGGSNIGTNRQTPAETDIGMVAHYFEKYQFDGLIIVGG
FEAFVSLNQLEQARSMYPAFRIPMVLIPATISNNVPGTEYSLGADTCLNALMDYCDIIKQ
SASATRGRAFVIEVQGGNSGYIATFSALVSGAQASYVPEEGIHLQQLEMDISSLREGFAV
DKDLTKAGKLIIKSSNASSVLTPQVLADIINAESKGEFDTKTAIPGHVQQGGLPSPIDRT
RADRFAIKAVQFIEEHADIMEPVRYTLDFPHDEPKYADTATVLGVKSSHLKFTSIRRLFD
FETELKRRMPKKVFWSKIRDIADDLVGRTRYRTT
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaggtatgaatgctgcagtgagagctgtggtgagagcagcagtgtttagaggt
tgcaaagcttttgcaatcaaggaaggttacgaagggcttgttcgaggtggagagaaatac
attacagaaatgaaatggcaggatgtgagaggtttcttgagtgatggtggtacaaatatt
ggaactgctaggtgcatggaattcaaggagcgagaaggtcgattgaaaggatgtcgtcac
ttgattgaagcgggaattgacggtttaattgtttgtggaggtgatggatcattgactggt
gcagatttatttagatctgaatggccatcattaatctccgaacttcgcgaaagaaaggag
atcacagaggaacaatatgaaagacacaaacatctctacatctgtggtatggtgggctcc
attgataatgatatggccacaactgactcaaccattgggtgttactcggcgttggaaagg
atatgtcgtgcagttgattatatcgatgccactgccaactctcatagtcgagcatttgtt
gttgaggtgatgggtagacattgtggatggttagcattgatggccggtatcgcaacaagt
gcagactatattttgattccagaaaagcctgcttcatcacatgactggcaagatcagatg
actacaattgtgaaaaaccatagagctgctggtaagagaaagacaattgtgattgttgcc
gaaggtgcaattactatagacttgaaaccaattagctcagaggatgtcaaggacgtattg
gtggaccgtttgggtttggatacgagaattactacattgggacatgtgcaaagaggtgga
tcggccgtctcttttgataggatcttggctactctccaaggtgtcgaagccgttaaagca
gtattggatttgacgccagacacaccttcacccttgattgccattgatgagaatcaagtg
gtgagaaggccattggttgaggcagtcaagattaccaagtctgtggcacaagctattgcc
gaaagagattttgaaaaagccatgtccttgagggattctgagtttaaagaacatttggct
aattttatggcaatgaacagtgcctgtcacgataaaccagttttgccagtggaaaaaagg
aaaaagattgccatcatcaacattggtgctcctgctggtggtatgaactcagcgacgtat
gccatggccacatattgtatgtcccaaggtcacactccatatgctatacataatggattt
gcaggtttgtcaaggcacgagtcagtgaaatctattgagtggattgatatcgaaggatgg
aacagtgttggtggttcaaacattggtacaaataggcagacaccagccgagacggatatt
ggtatggttgcccattactttgaaaagtaccaatttgatgggttgatcattgtgggaggt
tttgaggcttttgtttcgttgaatcaacttgagcaggcgagatcaatgtatcctgctttc
aggatccccatggttttgatcccagcaaccatttcaaacaatgttcctggtacagaatat
tcgcttggtgcagatacatgtttaaacgcacttatggactattgtgatatcattaaacag
tctgcatcagcaactagaggcagagcgtttgttattgaagttcaaggaggaaactctggt
tatattgctacattttctgcattggtgagtggagctcaagcctcttatgttccagaagaa
ggaattcatttgcaacaattggaaatggatatcagctccttgcgcgaaggttttgctgtc
gataaagacctcaccaaagcaggtaaattgatcatcaaatcttccaatgcatcatctgta
ctcactccacaagtgcttgctgatataatcaatgctgaaagcaaaggagagtttgacaca
aagaccgctatcccgggacacgttcaacagggtggattgccttcacctattgaccgtact
agagccgatagatttgccatcaaggctgtgcaattcattgaggaacacgccgatataatg
gagcctgttagatacacgcttgatttcccacacgatgaacctaagtatgcagatactgca
actgttcttggtgttaagtcgtcgcacttgaaatttacttccatcagacgattgtttgat
tttgagactgagttgaagagaagaatgcccaaaaaggtgttttggagcaagattagagac
attgccgatgatctcgttggtagaacgaggtacagaacaacatga

DBGET integrated database retrieval system