KEGG   Lodderomyces elongisporus: LELG_05130Help
Entry
LELG_05130        CDS       T01116                                 

Definition
(RefSeq) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00562  Inositol phosphate metabolism
lel01100  Metabolic pathways
lel04070  Phosphatidylinositol signaling system
lel04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LELG_05130
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LELG_05130
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LELG_05130
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LELG_05130
Membrane trafficking [BR:lel04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    LELG_05130
 Endocytosis
  Macropinocytosis
   Phospholipase C
    LELG_05130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2
Motif
Other DBs
NCBI-GeneID: 5230721
NCBI-ProteinID: XP_001523714
UniProt: A5E691
AA seq 538 aa AA seqDB search
MLNQQNLATPPQSPPQSLLYFSHPLTDYYISSSHNTYLIGRQVGGESSLEGYIKALKKGC
RCVEIDVWDGSGGGASSLVLDGNSANTNTNGGTSAATIAVVAEPVVNHGRTFTKSIKFSD
VIRTIKEYAFESSPYPVILSLEINCSANYQRSVVTIIKETLGKSLVTETINEYSILPSPE
DLKYRFLVKVKKTSPFKDLFETEDGSYTTSTTTPTSFSEDNCNININGNNKLQSGLGIGG
LRRVTAPKIIDVLSELGVYIQGIKFRNFSLPESKVYNHCFSLSEKATNKMLKDEVKRTSL
DKHNRKYFLRVYPSRFRLKSSNFIPINYWKIGVQMVATNWQTYDLGQQLNEAMFEDPHNK
SGYVLKPSYLRKPIIKSSKFYKMPSPPAEKIKFSITIVGAHELPTSTYADVLNPFVTVEV
IGADSIESDTEEGELGKRTRVINNNGFSPIWDETFNGEITGLRDFIFVKFVVGSYSTPWS
ESSKFDTHTPATVAMVVTKLDHLQQGYQHLHLKDPFGERLPFSSLFVKVSYEYNANLM
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatcaacagaatcttgcaacgcctccacaatcccctccacagtctttgctgtac
ttttcacatccactcaccgactattatatatcatcttcgcataacacatatctaatagga
cgacaagttggtggggagtcttcccttgaaggatacatcaaagcacttaaaaaaggctgt
agatgtgtagagattgatgtgtgggacggttcgggaggaggagcaagcagtctggtgttg
gatggaaacagtgcaaatacaaataccaatggtgggactagtgctgctactatcgctgtt
gttgccgagccagtggtgaaccatggacgaacatttaccaaatctatcaaattctcagat
gtgataagaacaattaaggaatatgcatttgaaagctctccttacccagttattctaagt
ttggaaattaactgctctgcaaactaccagagaagtgtggttacaatcataaaagagact
ttaggtaagagtttggttactgaaacaatcaacgagtactcgatactaccctcgcctgaa
gatttaaagtaccgttttttggtaaaggtgaaaaagacaagtccatttaaggatttgttt
gagacagaagacggaagctatacgacatcaacaaccacgcccacttcatttagcgaagat
aattgcaatattaatattaatggtaataacaagctgcaatcaggcttaggtataggaggg
cttcgtcgagtcactgcaccaaaaatcatcgatgtactaagtgagttgggcgtatatatc
caaggcataaaatttcgcaacttttcattacccgagtcaaaagtttacaaccactgtttt
tcgttaagcgaaaaagccacgaacaagatgttgaaagatgaggttaagcgcacatcgcta
gacaagcataacaggaaatattttttacgagtttacccatcaagatttcgactcaaatcg
tccaactttatccccatcaattattggaaaattggagttcagatggtggccacgaactgg
cagacatatgacttgggtcaacaactcaacgaggcaatgtttgaagatccgcataataag
agcggatacgttctaaaaccttcatacttgcgtaaacccattattaagagttcgaaattt
tacaagatgccttctccgccggcggagaagatcaagtttagcattactatagttggtgct
catgagctacccacaagcacatatgccgatgtgttaaatccatttgtaactgttgaggtc
atcggagctgacagtatcgaatctgatacagaagagggcgagttgggaaaaaggactaga
gtgatcaataataatggttttagtcccatatgggatgagacttttaatggagagattaca
ggtttgagagatttcatttttgtgaaatttgttgttggatcctattctacaccatggtcc
gagtcgagcaaattcgacactcatacaccagctaccgtggcaatggttgtaacaaagttg
gatcatttacaacaagggtatcagcacttacatttaaaagaccctttcggtgaaagatta
ccgttttcttccctatttgtcaaagtatcttatgagtataatgcaaatctaatgtaa

DBGET integrated database retrieval system