KEGG   Lodderomyces elongisporus: LELG_05152Help
Entry
LELG_05152        CDS       T01116                                 

Definition
similar to catechol O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
lel  Lodderomyces elongisporus
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    LELG_05152
Enzymes [BR:lel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     LELG_05152
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LELG_05152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 183 aa AA seqDB search
MSDSTESKEERFHQYLLNLPKEKKDAIRGKPHEVLKIIDEYPEHFMNIGQEKGKIISKHI
REKSPKIMIELGGYLGYSAVLFANELVEDPEAKYFSFEANADFAKIAKDVIELAGLSKKI
EIIVGKAAYTLVEFKERLSRNHGLKPIDFIFIDHWKDLYVPDLRELESLNFVAPGTIITV
CIR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactcaacagaatccaaagaggaaagattccaccaatatttgttaaacttacca
aaggaaaagaaggacgcaattagaggtaagccacacgaagtccttaaaattatcgatgag
taccctgagcatttcatgaatattggccaagagaagggtaaaatcatttcaaagcatatt
agagaaaaaagccccaaaatcatgattgaattgggcgggtatttggggtactctgcggtt
ctttttgcaaatgagttggtcgaggaccccgaagccaagtatttcagttttgaagcaaat
gcagattttgctaaaattgccaaagatgtgattgagttggcggggttgtccaagaaaata
gaaattatcgttggtaaagcagcgtacactttagtcgaattcaaggagagattgagtaga
aatcatggactgaaaccaattgatttcatctttattgatcattggaaagacttgtacgtg
cctgatcttagagagttggaatcattgaactttgttgcaccaggaacaatcataactgta
tgtattaggtaa

DBGET integrated database retrieval system