KEGG   Lodderomyces elongisporus: LELG_05168Help
Entry
LELG_05168        CDS       T01116                                 

Definition
similar to pyrazinamidase/nicotinamidase
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
lel  Lodderomyces elongisporus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LELG_05168
Enzymes [BR:lel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     LELG_05168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 219 aa AA seqDB search
MTKKALVVVDLQEDFLEPTGSLKIKRSKEIISQIIDILHEKTFDLYIATLDWHPANHTSF
ASQHGVEPFTELEFHHPETGEAKKQFVWPDHCIQNTHGSRLAPSFAEAFDKLPTNKKSII
KKGYLQDREYYSCFQDTWGIHHTEIEGLLKDNQIKEVTFVGLAYDYCVLNSAIDCAHQKF
KTFVVKSLCRSVSEENDERTTTMYKKNGVTVVDSILEVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaagccttagtagttgtggatcttcaagaagattttcttgaaccaacaggt
tccttgaaaataaaaagaagcaaggagataatcagtcagatcatagacattttacacgag
aaaacgtttgacttgtatattgcaacgttggattggcatcccgcaaatcatacctcattt
gcctcacagcatggtgttgaaccattcacagaattagagttccatcatccagaaaccgga
gaggctaagaagcaatttgtatggcccgaccattgtatccagaatactcatggctctagg
cttgctccatcatttgcagaggcttttgataaattgccgacaaacaaaaagtctatcatc
aaaaagggatatcttcaggatagagaatattactcttgtttccaagatacatgggggatc
caccatactgaaatcgaaggtttgctaaaagacaaccagatcaaggaggtaacttttgtt
ggattggcatatgattactgcgtcctcaactctgcaattgactgtgctcatcaaaagttc
aagacatttgttgttaaaagcttatgtcgaagcgtttctgaggagaatgatgagaggaca
accactatgtataaaaagaatggagtaacagttgttgattctatattagaggtgttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system