KEGG   Lodderomyces elongisporus: LELG_05205Help
Entry
LELG_05205        CDS       T01116                                 

Definition
similar to protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LELG_05205
Enzymes [BR:lel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LELG_05205
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LELG_05205
  Exosomal proteins of colorectal cancer cells
   LELG_05205
  Exosomal proteins of bladder cancer cells
   LELG_05205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 547 aa AA seqDB search
MQFWKYSTKVLATLLAVVSVSQAGGPADGDAVADPNSAVVKLTSDNFASFLEENPLVLTE
FFAPWCGYCKMLGPEFSKAADSLNESHPKIKLAQVDCTQDEELCMEFGIRGYPTLKIIRD
GDSKQAEDYQGPREASGIAEHMIKQSLPAVQIPETWEDLEKLIEEQTKPFVLQVNSATDD
IFQKVANVKRKDFSFINVGKDFIKQLGTKLNKDLKKASYLVVHPKQLADAIGFDGKKADV
ESLTKWIDVETLPYFGEMDRDTYMSYMTSPLPLAYYFYKTAEQREAVADDLAKLGKQYRG
KINIVGLDANLYGRHAEAINMDPEVVPLFAIQLIEDNKKYGINQKEYPEGPSVKVIEKFV
KDYFDGKLKPIVKSEELPTAEEIAANPVVKLVGHNYNDILNNSEKDIFVKYYAPWCGHCK
KLAPTWEELAEIFGSNKGETGVIIADIDHTANDVDVPFEIQGYPTLLLFPANGEIDEKTG
LRKPVVFEGQRELDSLIDFVKENGALKVDGTELQAKLKEAREAAEEAAGDAKDEVEEAAE
KVEHDEL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcaattctggaaatactctacaaaggtgctcgccactcttttggctgttgtctcagtc
tcacaagcaggtggcccagctgatggtgatgcagttgccgacccaaatagtgccgttgtg
aaattgacttcggataatttcgcttctttcctcgaggagaaccccttggtgttgactgag
tttttcgctccatggtgtggatactgtaagatgttgggacctgaattctccaaggctgcc
gactcccttaacgaatcacacccaaagatcaaattggcgcaagttgactgtacccaggat
gaggaattgtgtatggagtttggaattagaggatacccaacattgaagattatcagagat
ggtgactctaagcaagctgaagactaccaaggtccaagagaagctagtggtattgctgaa
catatgatcaaacaatccttgcctgctgttcaaattccagaaacatgggaagatttggag
aaattgattgaagagcaaaccaagccatttgtcttgcaagtcaactcagccacagacgat
attttccaaaaagtggccaatgtcaagagaaaagatttctcatttatcaacgttggcaag
gactttattaagcaattgggtacaaaattgaacaaggacttgaagaaagcatcatacttg
gttgttcatccaaagcaacttgctgatgctattggctttgacggtaaaaaggctgatgtc
gagagcttgaccaaatggatcgatgttgagacattaccatactttggtgagatggataga
gacacatatatgtcatacatgacctcaccattgccacttgcgtactacttttacaagacc
gcagagcaaagagaagccgttgccgatgatttggccaaattaggaaagcaatacagaggt
aagatcaacattgttggtttagacgccaacttgtatggaagacacgccgaggcaatcaat
atggacccagaagttgttccattatttgccattcaactcattgaagacaataagaagtat
ggtattaaccaaaaagagtaccctgaaggtccatctgttaaagtcattgagaagttcgtc
aaggactactttgatggcaaattgaagccaattgtcaaatctgaggagttacctactgca
gaggaaattgctgctaacccagtggtgaagttggttgggcacaactacaatgatatcttg
aacaatagtgaaaaggatatctttgtcaagtattatgctccatggtgtggccactgtaag
aagttggcacctacttgggaagagttggctgaaatttttggttctaataagggcgagaca
ggtgttattattgctgatattgaccacactgcaaatgatgttgatgtgccatttgaaatt
caaggatacccaaccttattgttgttcccagctaatggtgagattgacgaaaagaccgga
ttgagaaagccagttgtgtttgaaggccaaagagaattggattcgttgattgatttcgtt
aaagagaatggtgcattaaaggttgacggtactgaattacaagctaaattgaaagaagct
agggaagctgctgaagaagctgctggagatgccaaggatgaagttgaagaagctgctgag
aaagttgagcacgatgaattgtaa

DBGET integrated database retrieval system