KEGG   Lodderomyces elongisporus: LELG_05210Help
Entry
LELG_05210        CDS       T01116                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lel  Lodderomyces elongisporus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LELG_05210
   00670 One carbon pool by folate
    LELG_05210
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LELG_05210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 211 aa AA seqDB search
MTSEKPTISIIVAALKPSYGIGNKGKLPWRLRKEMAYFKRVTLRTTHTQNAVIMGRKTWE
SIPVKFRPLPDRLNIVLSRSFANEEQENGVIHANSIGRCVELIKEKNLLKVFIIGGSEIY
HAFLREKGLVDYLLITEIEQDVKNAEGKDKEGKTKEEEVKEVEMDTFLKFDTNEWVMGSQ
EELKEYTGETEIETNVKEGDFTYNYTIWKRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgaaaaacctacaatctcaataattgttgctgcactcaaaccaagctacggg
attggcaataaggggaaactaccatggcgtctacgtaaggaaatggcgtatttcaaacgc
gttaccctgcgaactacacacacccaaaatgccgttatcatgggccgcaagacttgggaa
tccattcctgtgaaattccgtccgttgccagatagattaaatattgtgctttcgcgttcc
tttgccaatgaagagcaagaaaatggagttattcatgcaaattccattggcagatgcgtg
gaattgatcaaggaaaaaaacttgctgaaagtattcatcattggtggaagtgagatatat
catgcatttttgagagaaaaggggttggtcgactatttgttgattacagagattgaacaa
gatgtaaaaaatgccgagggcaaggacaaggaggggaaaaccaaagaagaagaagtgaag
gaagtggagatggatacgttcttaaagtttgacactaatgaatgggtcatgggaagtcaa
gaagaattaaaggagtatactggggaaactgaaattgagactaatgtcaaggaaggtgat
ttcacttacaattacacaatctggaagagaaagtaa

DBGET integrated database retrieval system