KEGG   Lodderomyces elongisporus: LELG_05210Help
Entry
LELG_05210        CDS       T01116                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lel  Lodderomyces elongisporus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lel00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lel00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 211 aa AA seqDB search
MTSEKPTISIIVAALKPSYGIGNKGKLPWRLRKEMAYFKRVTLRTTHTQNAVIMGRKTWE
SIPVKFRPLPDRLNIVLSRSFANEEQENGVIHANSIGRCVELIKEKNLLKVFIIGGSEIY
HAFLREKGLVDYLLITEIEQDVKNAEGKDKEGKTKEEEVKEVEMDTFLKFDTNEWVMGSQ
EELKEYTGETEIETNVKEGDFTYNYTIWKRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgaaaaacctacaatctcaataattgttgctgcactcaaaccaagctacggg
attggcaataaggggaaactaccatggcgtctacgtaaggaaatggcgtatttcaaacgc
gttaccctgcgaactacacacacccaaaatgccgttatcatgggccgcaagacttgggaa
tccattcctgtgaaattccgtccgttgccagatagattaaatattgtgctttcgcgttcc
tttgccaatgaagagcaagaaaatggagttattcatgcaaattccattggcagatgcgtg
gaattgatcaaggaaaaaaacttgctgaaagtattcatcattggtggaagtgagatatat
catgcatttttgagagaaaaggggttggtcgactatttgttgattacagagattgaacaa
gatgtaaaaaatgccgagggcaaggacaaggaggggaaaaccaaagaagaagaagtgaag
gaagtggagatggatacgttcttaaagtttgacactaatgaatgggtcatgggaagtcaa
gaagaattaaaggagtatactggggaaactgaaattgagactaatgtcaaggaaggtgat
ttcacttacaattacacaatctggaagagaaagtaa

DBGET integrated database retrieval system