KEGG   Lodderomyces elongisporus: LELG_05241Help
Entry
LELG_05241        CDS       T01116                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LELG_05241
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LELG_05241
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LELG_05241
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LELG_05241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 424 aa AA seqDB search
MTKTSGHLTIVVKIGSSSLVDAVTREPRIANLAHIVETVTKLRRQGHRIVIVSSGAIAFG
MRVMNLSKKPTKLSEVQALASIGQGRLIGLFNSMFQQLGQTSSQILLTRNDINDFTQYRN
AQNTMDSLLEMGVIPIVNENDTLSVSEIKFGDNDTLSAITAGMVHADYLFLMTDVECLYL
DNPKTNPDAKPILVVDRVDELNVVTSEEAGSGVGTGGMTTKLIAAGLATSVGVTTIITLS
NQPHYILDIVAHIQSQKEVSITEQEQILQRDIDKKIIPLHTRFLSLPQLAKIKSDKKFWI
LHGLKTKGTLVIDQGCYAALTRRDRAGLLPAGIVDVVGNFHENECVSIKVIGSNTEEIGH
CRVNYSANEIRAIKGHKSNEIESILGYADSEYVAHRDSLAFPPLTPSESHVSLVNAGKEA
AKAV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactagtggacacctcacgattgtggtcaagattggttcatcgtccttggtc
gatgctgtgacccgggagcctagaattgcaaacttagcccacatagtcgagactgttaca
aagctaaggcgacagggccataggattgtgattgtttcatctggtgctattgcatttgga
atgagggttatgaacttgagcaagaaacctacaaagctatcggaagtccaagccttggcg
tctattggacaagggagacttatagggttgtttaatagcatgtttcagcaattgggtcaa
accagtagtcagatattgttgactcgaaatgatataaatgactttacgcaatacagaaat
gcacagaatacgatggactctttattggagatgggcgtgatacctatagttaatgaaaat
gacacattatccgtttcagaaatcaagtttggtgataacgatacattatcggcaatcacg
gcaggtatggtgcatgcagactacttgtttctcatgacagatgttgaatgtctttacctg
gacaatccaaagaccaacccagatgcaaaaccaattttggtagttgatagagtagacgaa
ttgaacgtggtcactagtgaggaagcaggatccggcgttggcacgggaggaatgacgaca
aagttgattgctgctggcttagctaccagtgttggagtgactacaattattactttgtcg
aatcaacctcactatatactagacattgttgcgcatatccagtcgcaaaaagaggttagc
ataactgaacaagaacaaatattgcagcgagatatagacaaaaagattatcccattgcac
accaggttcttgagcttaccgcaactggcaaaaatcaagtcggataaaaagttttggatc
ttgcatgggttaaagaccaagggcacattggtgatagaccaaggttgctatgcggcattg
acaaggagggaccgtgctggtttattgcctgcaggtattgttgatgttgtgggcaatttt
catgaaaacgaatgtgtttcgatcaaagttattggtagcaatactgaagagattggacat
tgtcgtgttaactactctgctaatgaaatacgtgcaattaagggacacaagagtaatgaa
atcgagtctatattgggctatgcagatagtgagtacgttgctcatagagacagtttggca
tttccgccactcacgccttcagagtcacatgtatcattggtcaatgctggaaaggaagcg
gcaaaagcagtctag

DBGET integrated database retrieval system