KEGG   Lodderomyces elongisporus: LELG_05245Help
Entry
LELG_05245        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lel  Lodderomyces elongisporus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LELG_05245
Translation factors [BR:lel03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LELG_05245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 277 aa AA seqDB search
MAWDDEDFDIPSNSKTAVSWEDEEDDDPVLESWDIDPEEEAKKKKAEQEAEAKKKAELKA
KEDEAKKKRDAKKKEMEEFDGLDERTRKELLKKAELNADLNNAADLFGGLGVAEDGDEDF
DINEHPREKARLAALQAARSKPVLTKDTPLEDHPLFQPTNKQEYERLRKTLGATLTALSE
DSSLLYASSLAIDLIRDLTQPLSVENTRKVVSTLNVVVKDKERQERTARLKKAGGTSTGG
AGKKKAKPAARPNVGGFKKDEFDDMGAFDDLDDDDFM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggacgacgaagattttgatattccttccaacagcaagacggcagtgtcttgg
gaagacgaagaagatgatgatccagttttggaatcttgggatattgaccccgaagaagag
gcaaagaaaaagaaagcagagcaagaagcagaggctaagaaaaaagccgaattgaaagct
aaggaagacgaggccaaaaagaagagggatgccaagaagaaagaaatggaagaattcgat
gggttggatgaaagaacaaggaaggaacttttgaagaaggctgaattgaatgccgatttg
aacaatgcagcagatctctttggcggattgggtgttgccgaagacggtgacgaagatttc
gacattaatgagcatccacgagaaaaagctagattggcagcacttcaggcagctcgtagc
aagccagtgttgacaaaggatacccccttagaagaccatccattgttccaaccaacaaat
aagcaagagtatgagagattgagaaagacattgggagcaacattgaccgcattaagcgaa
gacagctctttattgtacgcttcaagtctagcaattgatttgattagagacttgacccag
ccattatcagtagagaatacaagaaaagttgttagtacattaaatgtggttgttaaagac
aaagagagacaagaacgaactgctagattgaagaaagccggcggtacttccactggtggc
gctggtaaaaagaaggctaagccagctgcaagaccaaacgttggaggtttcaagaaggac
gagtttgatgatatgggggcattcgatgacttggacgacgacgactttatgtaa

DBGET integrated database retrieval system