KEGG   Lodderomyces elongisporus: LELG_05264Help
Entry
LELG_05264        CDS       T01116                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
lel  Lodderomyces elongisporus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LELG_05264
Translation factors [BR:lel03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LELG_05264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 214 aa AA seqDB search
MSEELTKKTEDLSLDSKQESAEKTVFDSKEEFTAKHPLNHRWTLWYTKPQTNKSENWHDL
LKPVIAFSSVEEFWGIYNSIPSANQIPLKSDYHLFKEGIRPEWEDEANAKGGKWQHAFLK
KEGNPIINDLWLRGLLAVIGETIEDDEDEVNGIVINVRKQVYRIGIWTKDCDESKLRTVG
ERLKKILQLKDDQRVEFISHNASNQKGAEPQIVL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaattaactaagaaaacagaagacttgtcgttagattccaaacaagagtcc
gcagaaaagactgtttttgattccaaagaagaattcaccgcaaagcacccattgaatcac
agatggactctttggtatacaaagccacagactaacaagtctgaaaactggcacgatctt
ttgaaaccagtgattgcgttttcgtcagtagaggagttttggggtatctacaactcgatc
ccatctgctaaccaaattccattaaagtcagactaccacttgttcaaagaaggtatcaga
cccgagtgggaagatgaggccaacgccaaaggtggtaaatggcaacacgcattcctgaaa
aaggaaggtaacccaatcatcaacgacttgtggcttagaggattgcttgccgttattggt
gaaaccattgaagacgacgaagatgaagtcaacggaattgttatcaacgttagaaagcaa
gtttacagaatcggtatctggaccaaggactgtgatgagtcgaaattaagaaccgttgga
gagagattaaagaaaatcttacaattgaaagacgaccagcgagtcgagtttatctcgcac
aacgcatcgaaccaaaaaggtgctgaaccacaaattgtcttgtaa

DBGET integrated database retrieval system