KEGG   Lodderomyces elongisporus: LELG_05346Help
Entry
LELG_05346        CDS       T01116                                 

Definition
similar to Mps1p
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:lel00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    LELG_05346
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     LELG_05346
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: Other group
  TTK family
   LELG_05346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 785 aa AA seqDB search
MPYDNMVNGPIRSMGSKESKDIHNTIKRISPNSSNSTKRAFEEDPTTTFLPPSLSSYSIA
SLNVRNRSLGFFTASLSSTAATAAATGAATGAAIGATGIYEKDLPTSNSENTSIKDKIRA
HFSGSNQSTLNTDFASMQPTLQHTRASIDEGENHSSPASNSLLNTSKADNSFLKIKRRRM
FGKKLGSPKRATGDEVKPQEKMDLDKIPVMELEMPIDNNVKVESPSDPTIDELVIRRRVE
ERREKERLEKEKLEKERLEQQRQLEREKEEQQRAELVRMEQHRIELRRLELEEEARERAR
LHQLREKEFFEQRKKEQQRSDMKLQPSEQMGQGNRFSNNKKDTFLPLKSPFKDKRVPLSD
VSPNVFRKPKLPKAVVRHDTRQEAPHAQQRQQHLQQQQQQSAHQEPRSQLEIQPLKDQHK
YNAPPTNNTMEEEVNNNAATTTTTTTASERKRTVQINGKYYEKLELLGRGGSSKVYRIKS
VADGRQYALKKVTLNQFENMNSFKGEIDLLLKLRHSKRVVKLVDHAVFTSSIYLIMERGD
IDLAILFQNRISAKLPLDIHFVKYHIHEMFKCVEDVHNAGIVHSDLKPANFLMVKGVLKI
IDFGIANAVPDHTVNIYRESQIGTPNYMAPEALVEANLVGAKNTTWKVGRPSDVWSCGCI
LYQFIYGKPPYAAYSGTQRVMAIMNPQVKIQYPAMGMGDVKVPTSAIQLMKNCLARDPGD
RWTIEQCLSSDFFCPKVVNETVVAKIVHESINFGFNKRVHGEGMSTDDYDAMVDDIIKQI
EACNC
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgataacatggtcaatgggcctatcagatccatgggatctaaagaatcaaaa
gatatacacaacacgattaaacgcatatctccaaatagctcaaactccaccaaacgagcg
tttgaagaagacccgacaacgacgtttttaccaccatcactcagctcgtatagtatagcc
tcgctaaatgttagaaacaggtctcttggctttttcactgccagtttgtcctcaacagca
gctacagcagcagctacaggagcagctacaggagcagctataggagctacagggatttat
gaaaaagatttacccacctcaaactctgaaaacaccagtatcaaagacaagatacgtgca
catttctctggcagcaatcaatcgacattaaacacagactttgcttcgatgcaacctaca
ttacaacacacacgtgcatcaattgatgaaggagaaaaccattctagtcccgcatccaac
tctttactcaatacgagcaaggcggataacagttttctgaaaatcaagagaaggcgaatg
tttggtaagaaattgggatctcccaaacgagcaacaggagatgaggttaaaccgcaagaa
aagatggatttagataaaataccggtgatggaattggagatgccaatcgacaataatgtg
aaggtagaatcaccaagtgatcccacaattgatgagcttgtcattcgtcgacgagttgaa
gaaagaagagaaaaagaacgcttggaaaaagagaaattggagaaggaaagattggagcaa
caacgacaattggagagagaaaaggaagagcaacagagagcagagctcgttcgcatggaa
caacatcgaatagagttgcgacgattggaattggaggaagaggctcgagaacgtgcaaga
ttacatcagctaagggagaaagaattctttgaacagcgcaaaaaagaacaacaaagatct
gatatgaaattgcaaccatctgaacaaatgggacagggaaaccgcttttcaaataacaaa
aaggatacatttcttccattaaaatcaccgttcaaggataaacgagtgccattgtctgat
gtatcaccaaatgtgtttagaaaacccaaattgcctaaagctgtggtacggcacgacaca
cgacaagaggcaccccatgcacaacaaagacagcagcatctacaacaacaacaacaacag
tcagcgcaccaagaaccacgctctcaactcgaaatccaaccattgaaggatcaacacaaa
tacaatgcgccaccaaccaataacaccatggaagaagaagtcaacaacaatgctgctact
actactactactactactgcatcagagaggaagcgaacagtgcaaataaatggcaaatac
tatgaaaaattagaactactaggacgcgggggctcttcgaaagtttacagaatcaaatcg
gttgcagatggtcgacaatatgcattaaaaaaagttactttgaatcaatttgaaaacatg
aatagtttcaagggcgagattgacttgttgttgaaattgagacactcgaaaagagtagtc
aagcttgttgaccatgcagtgtttacttcttccatatatctcatcatggaacgaggtgat
attgacctcgcgatattgtttcagaataggatcagtgcaaaattacctttggacatccat
ttcgtcaaataccatatccacgaaatgttcaagtgtgtagaggatgtccacaatgcaggc
attgtgcacagtgatttgaaaccagcaaatttcctcatggttaaaggtgtgttgaagatt
atagattttggtattgccaatgctgtccccgaccataccgtgaatatctaccgcgaatca
caaataggaacaccaaactacatggcacccgaggctcttgtcgaggcaaacttagttggt
gccaagaacacgacatggaaagtaggaagaccttctgacgtttggtcttgtggatgtata
ttgtaccaattcatctatggcaaacctccgtatgcagcgtattctggaactcaaagagtg
atggcgataatgaacccccaggtaaaaatccagtacccagcaatggggatgggagatgtc
aaagtacccacaagtgcaatccaattgatgaagaattgtcttgctcgagatccaggagac
agatggacaattgaacagtgcttgtccagcgatttcttttgtcccaaggttgttaacgag
actgtggtggctaaaatagtacacgagagcattaattttgggttcaacaaacgtgttcat
ggagaaggaatgtccacggacgactacgatgcaatggtagacgacatcatcaaacaaata
gaagcatgtaattgctaa

DBGET integrated database retrieval system