KEGG   Lodderomyces elongisporus: LELG_05352Help
Entry
LELG_05352        CDS       T01116                                 

Definition
lysophospholipase 1 precursor
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:lel00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MFVQHFIYILLSVASIASAWSPTDSYAPGKVDCPSDVDLVRVADRISDEEESWLEGRDGV
TQDLIVEFLQNANMSDFDAESYVKGLNQSLHIGLAFSGGGYRAMLNGAGQLSALDSRTKG
NKSSDAQGLGGLLQASTYLAGLSGGSWLVGSIVMNNFTSVQDIIDKNEIWDLSHSIMNYG
GINVIKTYEYYKGISDDLDAKKDAGFELTLTDAWGRGLSHQFFSTLNDSGASMTFSSLQD
WDVFTEYKMPFPIFVSDTRAPNTQIISLNSSLNEFNPFEIGSWDSSIYQFSKIKYLGSEV
EDGEANGTCYAGFDNAGFVMGTSSTLFNQFILQINTTSLSSTVKSIITSFLKDFSKDEND
VAIYEPNPFYDTDVGTSEHIAQNETYTLVDGGEDGQNIPLWPLFQPTRDVDVVFAFDNSA
DTDESWPNGTSLVMSYERQFVDAGNSTIFPYVPDQQSFINLNLSAKPTFFGCDAKNLSSL
VQNDQTSVYDTPLLVYIANRPFSYWTNTSTFKMKYDTSERNSIIQNGFEVASRYNLTLDP
EWPACVGCAIIRRSQERNGEEQSEQCKQCFERYCWDGSLDTTTNEDRINFTSEGTTSDSE
SLKTSEGSSLVSKLSWSVWFSLLAALCMFLF
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttcaacactttatatacatcctcctatccgtggcttccatagcctcagcttgg
tcacccacagactcttatgcaccaggaaaagtggattgtccctccgatgtggatctcgtg
cgtgttgccgaccgtatctccgatgaggaagagtcctggttggaaggaagagatggcgtg
acacaggacctcattgttgagtttttacaaaatgcaaatatgtcagactttgatgccgag
agctacgtcaagggcttgaaccaaagcttacacattggattggcattctccggcggtggg
taccgtgccatgttgaatggtgcaggacaattgagtgctttggactcaagaaccaaggga
aataaaagttccgatgcgcaaggtttgggtggattgttgcaagcaagcacctaccttgcc
ggattatctggtggtagttggcttgtggggtcaattgttatgaacaactttacctcagta
caagacattatagacaagaatgagatttgggacttgagccactcaattatgaattatggt
ggtatcaatgttatcaaaacctatgaatactacaagggcatttcagacgatttggatgca
aagaaggatgccggtttcgaattgacattgaccgatgcctggggcagaggcttgtctcat
cagttcttttcgactttgaacgactctggtgcatccatgacttttagtagtttacaagat
tgggatgtgtttacagaatacaagatgccatttcccatctttgttagtgacactagagcg
ccaaacactcagattatcagcttgaactcgagtttgaatgaatttaacccatttgaaatt
ggaagttgggattcaagtatctaccaattcagtaagatcaagtacttgggatcagaggtt
gaagacggagaagcaaatggtacatgttatgcaggtttcgacaatgccgggtttgttatg
ggtacatcatccactttgtttaatcaattcattttgcaaatcaacaccacctcgttatca
tcaactgtcaagtctattatcacttcgtttttaaaagatttctccaaagatgaaaacgat
gttgccatttacgagccaaacccattctacgacaccgatgttggaacatcagaacacatt
gcgcaaaacgagacatacaccttggttgatggtggtgaagatggacaaaatatcccactt
tggccattgttccaacctactcgtgatgttgacgttgtttttgcatttgacaactcggca
gacacggatgagtcgtggcccaatggtacttctttagttatgtcgtacgagagacaattt
gtcgatgccggaaacagcaccatcttcccatacgtgcctgatcaacaatcattcatcaac
ttgaacttgtctgcaaaaccaaccttttttggttgtgacgccaagaatctttcgtcattg
gtgcaaaatgaccaaacaagcgtttatgatactccactcttggtatacattgccaaccgt
ccattcagttattggacaaacacttcaacattcaagatgaagtatgatacttctgagcgt
aattcgattatccaaaatgggtttgaagttgcttctcgttacaacttgacccttgaccct
gaatggccagcatgtgttggttgtgccatcattagaagatcacaagaacgtaatggggaa
gaacaaagtgaacaatgtaagcaatgttttgaaagatattgttgggatggaagcttggat
accacgacaaacgaagacagaatcaatttcacttcggaaggtactacaagcgattctgaa
tcattaaagaccagtgagggatcaagtttggtgagcaagttgagctggtccgtgtggttt
agtttattggctgcattgtgtatgttcctgttctga

DBGET integrated database retrieval system