KEGG   Lodderomyces elongisporus: LELG_05377Help
Entry
LELG_05377        CDS       T01116                                 

Definition
tubulin alpha chain
Orthology
K07374  
tubulin alpha
Organism
lel  Lodderomyces elongisporus
Pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:lel00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    LELG_05377
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LELG_05377
  Exosomal proteins of other body fluids (saliva and urine)
   LELG_05377
  Exosomal proteins of colorectal cancer cells
   LELG_05377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 448 aa AA seqDB search
MREVISINVGQAGCQIGNACWELYSQEHGIKPDGYLQEGLDRPKGGEEGFSTFFSETGSG
KYVPRALYVDLEPNVIDEVRTGLYKDLFHPEQLIAGKEDAANNYARGHYTVGREIMDDVL
DRVRRMSDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSMDYGKKSKLEFAVYPAPQVST
SVVEPYNTVLTTHTTLENADCTFMVDNEAIYDMCRRNLDISRPSFSALNNLIAQVVSSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPVFSKARANHEANSVSEITQSCFEPG
NQMVKCDPRTGKYMATCLLYRGDVVTRDVQNAVAQVKAKKNVQLVDWCPTGFKIGICYQP
PTAIQGSELASAQRAVCMLSNTTAIAEAWRRIDRKFDLMYSKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYVEVGTDSFPEEEEEY
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtcattagtatcaacgtcggacaagctggttgccagattggtaatgcatgc
tgggaattatactcgcaagaacacggaatcaagccagatggttacttgcaagaaggtttg
gacagaccaaaaggtggagaagaagggtttagcactttctttagcgagactggttccggt
aaatacgttccccgtgcgttgtatgttgatttagaaccaaatgttattgacgaagttaga
acaggtctttacaaagatttgttccacccagaacaattgattgctggtaaggaagatgcg
gcaaacaactatgcaagaggtcactatacagtgggaagagaaatcatggatgatgttttg
gacagagtcagaagaatgagtgaccaatgtgatggattacaaggtttcctctttacccat
tctttgggtggtggtactggttctggtttaggttctttgttactcgaacaattgtcgatg
gactatggtaagaaatccaaattggaatttgccgtttacccagcaccacaagtttctaca
tcagtcgttgagccatacaacactgtcttgactacacacactaccttggaaaatgcagac
tgtacttttatggttgacaatgaagccatttatgatatgtgtagaagaaacttggatatt
tctagaccaagctttagcgcattgaacaatttgattgctcaagttgtgtcatcggtgact
gcttctttgagatttgatggttcattaaatgttgacttgaacgagttccaaaccaacttg
gtgccatacccaagaatccatttcccattggtgagttatgcgccagttttctccaaggcc
agagccaaccatgaagctaactcggtttccgagattactcaatcttgtttcgaaccaggt
aaccaaatggtcaagtgtgatccaagaactggtaagtacatggccacctgtttgttgtac
cgtggtgacgttgtcactagagatgtgcaaaatgccgttgctcaagtcaaggccaagaag
aatgtccaattggttgattggtgtccaacaggtttcaagattggtatttgttaccaacca
ccaactgctattcaaggtagtgaattggccagtgcacaaagagccgtttgtatgttatca
aataccactgctattgctgaagcatggagaagaattgacagaaagtttgacttgatgtac
tcaaagagagcattcgtgcactggtatgttggagaaggtatggaagaaggagagtttaca
gaagctagagaagacttggctgcattggaaagagactacgttgaagttggtaccgattct
ttcccagaagaagaagaagagtattaa

DBGET integrated database retrieval system