KEGG   Lodderomyces elongisporus: LELG_05589Help
Entry
LELG_05589        CDS       T01116                                 

Definition
(RefSeq) activator 1 41 kDa subunit
  KO
K10755  replication factor C subunit 2/4
Organism
lel  Lodderomyces elongisporus
Pathway
lel03030  DNA replication
lel03420  Nucleotide excision repair
lel03430  Mismatch repair
Module
lel_M00289  RF-C complex
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LELG_05589
   03420 Nucleotide excision repair
    LELG_05589
   03430 Mismatch repair
    LELG_05589
DNA replication proteins [BR:lel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    LELG_05589
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     LELG_05589
Chromosome and associated proteins [BR:lel03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    LELG_05589
DNA repair and recombination proteins [BR:lel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    RFC (replication factor C)
     LELG_05589
  Check point factors
   HRAD17(Rad24)-RFC complex
    LELG_05589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Rep_fac_C DNA_pol3_delta2 Rad17 AAA_11 AAA_22 RuvB_N AAA_16 Mg_chelatase AAA_14 AAA_24 ResIII DUF815 AAA_23 AAA_30 AAA_assoc_2 AAA_5 DUF2075 TIP49 AAA_18 AAA_19 RNA_helicase AAA_28 AAA_3
Motif
Other DBs
NCBI-GeneID: 5230311
NCBI-ProteinID: XP_001523363
UniProt: A5E7K0
AA seq 402 aa AA seqDB search
MATTAAAATAAATATATAATTTDRSKYDEDKLHHTPWVEKYRPKNLDDVASQDHAVKVLK
KQISTGNLPHMLFYGPPGTGKTSTILALAKQLYGPNLYKSRVLELNASDERGISIVRQKI
KNFAKLTVSNPTEDDLRNYPCPPYKIIILDEADSMTNDAQSALRRTMETYANITRFALVC
NYITRIIDPLASRCSKFRFKLLNNENSLNRLKYIAKEENLHLDEKGAPDEVLNEVLRISN
GDMRKAITYLQSASKLSSSLQLENCKNDMNEDNKGESTPSSRKGDEKDDEEEEKDKGLIT
KASIRETAGILPDTLILQMVESIKQKNEGILINLVNDIISSGWSVQQLIDQLHDQLVWDD
TIDSLKKNQIALTLFDTDKKLNLGTDEHIQLLNLVLQVSGIV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacagcggcagcagcaacagcggcagcaacagcaacagcaacagcagcaaca
acaacagatagatcgaagtacgatgaggataagctccaccacacgccttgggttgagaaa
tacagacccaagaaccttgacgacgttgcctcacaagaccatgctgtcaaagtgctcaaa
aaacaaatctccaccggcaacttaccacacatgctcttctacggtcctccggggactggt
aagacgtcaaccatcctagcgcttgctaaacaattgtatggaccgaacctttacaagtcg
cgagtattggaactaaacgcgagtgatgaacgtggtatctctatagttcgacaaaagatc
aagaattttgccaagttaacagtgagcaacccgactgaggacgatttgcgaaattaccct
tgtccaccatacaagattattatattggatgaggctgactcaatgactaatgatgctcaa
agtgctttgagaagaacgatggagacatatgcgaatatcacaaggtttgcattagtgtgt
aactacatcacccgaatcattgacccattggcttcaagatgttctaaattcagattcaag
ttgttgaacaacgagaacagcttgaataggttgaaatatattgcaaaggaggagaactta
cacttggatgaaaagggtgcgccagatgaggttttgaacgaagtattgaggatcagcaat
ggagatatgagaaaagcaatcacgtatttacaaagtgcttctaaattgagcagcagtttg
caactagaaaattgtaagaacgacatgaacgaagataacaaaggtgaaagcacaccatca
tcaagaaaaggggatgaaaaagatgatgaggaggaggaaaaagataaagggcttatcaca
aaagcgtccatcagagaaacagctggaattttaccggatacattaatcttgcaaatggtt
gagtcaataaaacaaaaaaatgaagggattttaattaatttggttaatgatatcatttca
agtggctggagtgtacagcagttgattgatcagctacatgaccaattggtctgggacgac
actatagattcattgaaaaagaatcaaattgctttgacgttgtttgacacggataaaaaa
ctcaatcttggtaccgatgagcatatacaattgctcaatttggttctccaggtgtcaggt
attgtatag

DBGET integrated database retrieval system