KEGG   Lodderomyces elongisporus: LELG_05589Help
Entry
LELG_05589        CDS       T01116                                 

Definition
activator 1 41 kDa subunit
Orthology
K10755  
replication factor C subunit 2/4
Organism
lel  Lodderomyces elongisporus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:lel03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:lel03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lel03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MATTAAAATAAATATATAATTTDRSKYDEDKLHHTPWVEKYRPKNLDDVASQDHAVKVLK
KQISTGNLPHMLFYGPPGTGKTSTILALAKQLYGPNLYKSRVLELNASDERGISIVRQKI
KNFAKLTVSNPTEDDLRNYPCPPYKIIILDEADSMTNDAQSALRRTMETYANITRFALVC
NYITRIIDPLASRCSKFRFKLLNNENSLNRLKYIAKEENLHLDEKGAPDEVLNEVLRISN
GDMRKAITYLQSASKLSSSLQLENCKNDMNEDNKGESTPSSRKGDEKDDEEEEKDKGLIT
KASIRETAGILPDTLILQMVESIKQKNEGILINLVNDIISSGWSVQQLIDQLHDQLVWDD
TIDSLKKNQIALTLFDTDKKLNLGTDEHIQLLNLVLQVSGIV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacagcggcagcagcaacagcggcagcaacagcaacagcaacagcagcaaca
acaacagatagatcgaagtacgatgaggataagctccaccacacgccttgggttgagaaa
tacagacccaagaaccttgacgacgttgcctcacaagaccatgctgtcaaagtgctcaaa
aaacaaatctccaccggcaacttaccacacatgctcttctacggtcctccggggactggt
aagacgtcaaccatcctagcgcttgctaaacaattgtatggaccgaacctttacaagtcg
cgagtattggaactaaacgcgagtgatgaacgtggtatctctatagttcgacaaaagatc
aagaattttgccaagttaacagtgagcaacccgactgaggacgatttgcgaaattaccct
tgtccaccatacaagattattatattggatgaggctgactcaatgactaatgatgctcaa
agtgctttgagaagaacgatggagacatatgcgaatatcacaaggtttgcattagtgtgt
aactacatcacccgaatcattgacccattggcttcaagatgttctaaattcagattcaag
ttgttgaacaacgagaacagcttgaataggttgaaatatattgcaaaggaggagaactta
cacttggatgaaaagggtgcgccagatgaggttttgaacgaagtattgaggatcagcaat
ggagatatgagaaaagcaatcacgtatttacaaagtgcttctaaattgagcagcagtttg
caactagaaaattgtaagaacgacatgaacgaagataacaaaggtgaaagcacaccatca
tcaagaaaaggggatgaaaaagatgatgaggaggaggaaaaagataaagggcttatcaca
aaagcgtccatcagagaaacagctggaattttaccggatacattaatcttgcaaatggtt
gagtcaataaaacaaaaaaatgaagggattttaattaatttggttaatgatatcatttca
agtggctggagtgtacagcagttgattgatcagctacatgaccaattggtctgggacgac
actatagattcattgaaaaagaatcaaattgctttgacgttgtttgacacggataaaaaa
ctcaatcttggtaccgatgagcatatacaattgctcaatttggttctccaggtgtcaggt
attgtatag

DBGET integrated database retrieval system