KEGG   Lodderomyces elongisporus: LELG_05681Help
Entry
LELG_05681        CDS       T01116                                 

Definition
(RefSeq) similar to cytochrome b reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LELG_05681
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LELG_05681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9 AAR2
Motif
Other DBs
NCBI-GeneID: 5230252
NCBI-ProteinID: XP_001523135
UniProt: A5E7U2
AA seq 300 aa AA seqDB search
MAETETNPLVVFATVATIIISFVTLYFFKQSAKSSTTSSSSSSSSKSKKGSPALIPDKFQ
KFPLISKTQVSHNSAIYRFGLPNPTDTLNLPIGQHISIGTIIDGKEVVRSYTPISLGDQQ
GHFDLLIKTYENGNISRHVAEKQVGDFVEIRGPKGFFTYTPNMKKSLGLIAGGTGIAPMY
QIITAIMNNPEDKTKVHLLYANVTENDILLRDELEQYAKEHPDRLKIHHVLNEAPEGWQH
LTGFVTPELIDKHLPKPSADTNLLLCGPPPMISAMKKAAVSLGFDKAKPVSKLGDQVFVF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacagaaaccaacccactcgttgtgtttgcaacagttgcaaccatcattatc
tcattcgtcaccctctactttttcaagcaatctgctaagtcttccaccacctcctcctca
tcatcatcatcgagtaaatccaaaaagggttcaccagctttgattccagataagttccag
aaatttcctttgatttccaagacccaagtatcccataactctgctatctacagatttggt
ttgccaaacccaactgatacattgaacttgcctattggacaacacatttctattggaacc
attattgacggtaaggaagttgttcgttcatatacgccaatttctttgggtgaccaacag
ggacatttcgacttgttgatcaagacatatgaaaatggaaacatttcaagacacgttgct
gaaaagcaagttggtgatttcgtcgagattagaggtccaaaagggttctttacttatact
ccaaacatgaagaaatcattgggtttgattgctggaggtactggtattgcaccaatgtat
caaatcattactgctattatgaacaaccctgaagacaagaccaaagttcacttgttgtat
gccaatgtcactgagaatgatatcttgttaagagacgaattggaacagtatgctaaggaa
catccagatagattgaagatccaccatgtattaaacgaggcaccagaaggctggcaacac
ctgaccgggtttgtcactcctgagttgattgacaaacacttgccaaagccaagtgctgac
accaacttgttattgtgcggcccaccacctatgatcagtgcaatgaagaaagccgcagtc
agtttgggctttgacaaggctaagccagtaagtaaattgggtgaccaagtctttgttttt
taa

DBGET integrated database retrieval system