KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_0466Help
Entry
Lepto7376_0466    CDS       T02361                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lep00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526472..527665
Genome map
AA seq 397 aa AA seqDB search
MTDNPTFQEPDSNSEPMSEAKRALELETHLPLTGWQQEVDQGLEYGLEAADSIGDRTIST
FSRGELPHYAGINTFMKAPYVEDVRLVGNYDVAIVGVPHDSGTTYRPGTRFGPQGIRRIS
ALYTPYNFELGVDLREQIKLCDVGDIFTIPGNNEKSFDQISKGIAHIFSSGAFPIILGGD
HSIGFPTVRGICRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMANAPAKNLV
QLGIGGWQVPRQGVKVCRERATNILTVTDIMDMGMDAAVDFALERAMDGTDCVWISFDID
CIDAGFVPGTGWPEPGGLLPREALYLLGKIVSRAPVCGLEIVEVSPPYDVSDMTSLMATR
VICDTMAQLVLSGQLPRTEKPSYIHEEANMDIDQPWR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacagataacccaacttttcaggaaccagactccaattcagagccgatgtcagaagct
aaacgggcactggaactcgaaactcatcttcccttaacgggttggcagcaggaagttgac
caaggtctggaatatggtctagaggccgcagacagtatcggtgatcgcacgatttctaca
ttctctaggggtgagctgccccactatgcgggtatcaataccttcatgaaggcgccttat
gtcgaggatgttcgcctagtcggtaattatgatgtggcgatcgtcggtgtcccccacgat
tccggaaccacttatcgtccgggcactcgctttggtccccaaggtattcgccgaatatca
gctttgtacactccctataattttgaattaggcgttgatcttcgcgaacaaattaagctc
tgcgatgtcggtgatatctttacgattcctggcaataacgaaaaatcatttgatcaaatt
tctaaaggaatcgctcacatttttagttcgggtgctttcccaattatcttgggcggtgac
cattccattggctttccgacagtgcgtggaatttgtcgtcatttaggcgataaaaaagtc
ggcattattcactttgaccgccatgtcgatacccaagaaacggacttagacgagcggatg
cacacttgtccctggtttcatgcgaccaatatggccaatgcccccgcgaagaatctggta
cagctaggcatcggtggctggcaagtgcctcgccagggcgtcaaagtttgccgggaacgt
gcgaccaatatcctaactgtgaccgacatcatggatatgggcatggatgcagcggtagat
ttcgcattagagcgcgcgatggatggcacggactgtgtctggattagctttgatattgac
tgtatcgatgctggattcgtgccgggtacaggttggcctgagccaggtggattactcccc
cgtgaagcgctttatttgttgggtaaaattgtctcacgtgcgccggtttgtggcctagag
atagttgaagtttctccgccctatgacgtgagcgatatgacttcgctgatggcgacccgt
gtgatttgcgatacgatggctcagcttgtgctctctggtcaattgccacgtacagaaaag
cctagttatatccatgaagaagccaatatggatatagatcaaccctggcgttaa

DBGET integrated database retrieval system