KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_0795Help
Entry
Lepto7376_0795    CDS       T02361                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lep00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891374..892882
Genome map
AA seq 502 aa AA seqDB search
MTNSKYVMALDLGTTGNRALIFNGAGEIVAQTYKELPQHYPQPGWVEHDAMDIWNDTQSV
MQQAIKDNNIDPAEIAAIGLTVQRETCLLWDKTTGKPLHNAIVWQDRRTADFCQKLSAAG
KASEIYDKTGLVLDAYFSATKLNWLLDWAKENSDVNPENILAGTVDTWALWNLTGGKVHA
TDHSNASRTMLLNIQTQNWDPELLDMFGIPAHIMPKAQSSLGVFGYTAPALVGAEIPITA
IFGDQQAALYAHGCDRPGLLKCTYGTGAFLVAHTGDQIPRSQHKLLSTIACTQPNADKSA
TNVGYALEGSMFTAGACIQWLRDGLEIIKSASETEGLALSVSDNGGAYFVPALSGLGAPH
WDMAARGAFLGITRGVEKAHMVRAVLEAIAYQAKEVVDAINEDSGTPITTLKVDGGACNN
DFLMQFQADVLGIPVERPAVLDATAQGAAFAAGLAVGFWESYEKLVGDRQIDKVFTPGEG
AEAAQANFATWQKAVERAKDWV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactcaaaatatgtgatggccttggatctcggtaccactggtaaccgtgcctta
atttttaatggagcaggcgaaattgttgcccaaacctacaaagaattgcctcagcattac
cctcagccaggttgggtagaacacgacgcaatggacatttggaatgacacccaaagcgtt
atgcagcaggcaattaaagacaataatattgacccagctgaaattgcagcgattggttta
acagtccagcgtgaaacttgtttactttgggataaaaccacaggcaaaccgctccataat
gctatcgtttggcaggatcgtcgtaccgcagatttttgtcagaaactcagtgcagcaggt
aaagccagcgagatttatgacaagacaggcttagtgctggatgcctatttttctgcaaca
aaactaaattggttattggattgggcgaaggaaaatagcgacgttaatcctgaaaatatt
cttgccggaactgtagacacttgggcactttggaatctcacaggcggtaaagtccacgcg
acggatcacagtaacgccagtcggacaatgctcctcaatatccaaactcaaaattgggat
ccagaattgctggatatgtttggcatcccggcacacatcatgcccaaggcgcaatcgagt
ttgggtgtttttggctatacagctccagcattagtcggtgcagaaattcccattaccgct
atcttcggtgatcaacaagcagcgctttatgcccacggttgcgatcgccccggtttgttg
aaatgtacctatggcacgggtgcgttcctcgttgctcacactggcgatcaaatcccgcga
tcgcagcacaaacttttaagcaccattgcttgtactcagcctaatgccgataaaagtgcg
accaatgtgggctatgccttagaaggcagtatgtttacggcgggtgcttgtatccaatgg
ctacgggatggcctcgaaattattaaatctgccagtgaaacagaaggcctcgctttatct
gtttccgataatggcggcgcgtattttgtcccggccctgagcggtttaggcgccccccac
tgggacatggcagctcgcggcgctttccttggcattacgcgcggtgtcgaaaaagctcac
atggtaagggctgtccttgaggcgatcgcctaccaagcaaaagaagtagttgatgccatt
aacgaagattctgggacaccaatcaccaccttaaaagttgacggcggcgcttgtaataac
gattttctgatgcaatttcaagctgatgtgttgggtattcccgtcgaacgtcccgccgta
ctcgatgccacagcccaaggtgctgcatttgccgctggtctagcggttggattttgggag
agctacgaaaaactggtgggcgatcgccagatcgataaagtctttactcccggtgaagga
gctgaagctgctcaggccaattttgccacttggcagaaagctgtcgaacgcgccaaagat
tgggtttga

DBGET integrated database retrieval system