KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_0962Help
Entry
Lepto7376_0962    CDS       T02361                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lep01100  Metabolic pathways
lep01110  Biosynthesis of secondary metabolites
lep01130  Biosynthesis of antibiotics
lep01230  Biosynthesis of amino acids
Module
lep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lepto7376_0962
Enzymes [BR:lep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Lepto7376_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFY37335
UniProt: K9PV53
Position
1085717..1086607
Genome map
AA seq 296 aa AA seqDB search
MSVQIRRQHPSRPINVSILQYQVALPDAKPQHILEEIVWHKELEVEQMRDKMPLLQLRKL
VNTLPPAKDFLSALVNGKNNPALIAEVKKASPSKGVIREDFDPVAIAKAYEAGGASCLSV
LTDQKFFQGSFDNLKLVREAVDLPLLCKEFIIYPYQIFKARSFGADAVLLIAAILSDQDL
EYYVKITRSLGMTALVEVHTAEELDRVLAVDGVNLIGINNRNLEDFSVNIETTTMLMETR
SAELKAKGARVVSESGIHSPIDLMMVREAGAKAVLVGESLVKQPDPKQAITDLFEL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtccaaatccgccgtcaacaccccagtcgccccatcaatgtcagtattttgcaa
taccaagtggctctgccggatgcgaaaccccagcatattctcgaagaaatcgtttggcac
aaagagcttgaagttgagcagatgcgcgacaagatgcctctactgcaactccgtaaacta
gtaaacactctgccacctgcaaaggattttttatctgctctcgtaaacggtaaaaacaat
ccagcccttatcgccgaggtcaaaaaagcctctcccagtaaaggagtgattcgcgaagat
ttcgacccagtagcgatcgccaaagcctacgaagcaggtggtgcaagctgtttgtctgtt
ttaaccgatcagaaattctttcaaggcagctttgacaatctcaaactagtccgagaagcc
gttgatctaccgcttctctgcaaagaattcatcatctatccctaccaaatttttaaagcc
cgtagctttggtgctgacgcagtgctcctaattgctgcgatcttgtctgaccaagacctc
gaatactacgtcaaaatcacccgcagtctagggatgacagccctcgttgaagtgcataca
gcggaagaattagaccgagttttggcagttgatggtgtgaatctgattggcattaataac
cgtaacctcgaagatttttccgtcaatatcgaaaccacaacgatgttgatggaaacccgg
agtgctgagctgaaggcgaaaggggcgcgggtcgttagtgaatctggtattcacagtccc
attgacctcatgatggtgcgggaagctggtgcaaaagcagtactagtcggtgaatctctc
gtcaagcaacctgatccgaaacaggcgatcaccgatctattcgagctttaa

DBGET integrated database retrieval system