KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1539Help
Entry
Lepto7376_1539    CDS       T02361                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lep00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735556..1736278
Genome map
AA seq 240 aa AA seqDB search
MIKVISFKICPFVQRVTALLEAKQAPYEIQYIDLSNKPEWFLEISPNGQVPLLITESNDV
LFESDAIVEYIDEAIATPLFDSDLVKKAQERSWSYLATKHYLVQCSAQRSKDKGTLLDRS
HKLSKAFAKLESKLTNEKFFGGDQLDMVDIAWLPLLHRASIIEQHSGYDFIGQFPKVKAL
QKQLLATGLAEKSVSEDFEEKFAAFYLSEQTYLGQCAKTQLGKTCFGESDCRDEDFDCCS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtaatcagctttaaaatttgtccttttgttcagagagtcacagcgctttta
gaggcaaaacaggcaccatatgaaattcaatatattgatctcagcaataagccagagtgg
tttttagagatttcaccgaatgggcaagtgccacttttgattaccgaatcgaatgatgtg
ctgttcgaatctgatgccattgtggaatacattgacgaggcgatcgccacccctttgttt
gattccgacttggtgaaaaaagcacaggagcgttcatggtcatacctcgctaccaagcat
tacctggttcaatgtagtgcccagcgtagcaaggacaaagggactttattagatcgatct
cacaagttatcaaaggctttcgccaagttggaatccaagttaacgaatgaaaaattcttt
ggtggtgatcagttagatatggtcgatattgcctggttacctttactgcatcgagcttca
attattgagcaacattctggctacgatttcattggtcagtttcccaaagtgaaagcactg
caaaaacagctgttggcaactggcttggctgagaaatcggtgtcagaagattttgaagag
aagtttgcagcattctatttgtcagagcaaacttatttgggacaatgtgccaaaactcaa
ctcgggaaaacttgttttggagagtctgattgtagagacgaagattttgactgttgttct
taa

DBGET integrated database retrieval system