KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1539Help
Entry
Lepto7376_1539    CDS       T02361                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lepto7376_1539
Enzymes [BR:lep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Lepto7376_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735556..1736278
Genome map
AA seq 240 aa AA seqDB search
MIKVISFKICPFVQRVTALLEAKQAPYEIQYIDLSNKPEWFLEISPNGQVPLLITESNDV
LFESDAIVEYIDEAIATPLFDSDLVKKAQERSWSYLATKHYLVQCSAQRSKDKGTLLDRS
HKLSKAFAKLESKLTNEKFFGGDQLDMVDIAWLPLLHRASIIEQHSGYDFIGQFPKVKAL
QKQLLATGLAEKSVSEDFEEKFAAFYLSEQTYLGQCAKTQLGKTCFGESDCRDEDFDCCS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtaatcagctttaaaatttgtccttttgttcagagagtcacagcgctttta
gaggcaaaacaggcaccatatgaaattcaatatattgatctcagcaataagccagagtgg
tttttagagatttcaccgaatgggcaagtgccacttttgattaccgaatcgaatgatgtg
ctgttcgaatctgatgccattgtggaatacattgacgaggcgatcgccacccctttgttt
gattccgacttggtgaaaaaagcacaggagcgttcatggtcatacctcgctaccaagcat
tacctggttcaatgtagtgcccagcgtagcaaggacaaagggactttattagatcgatct
cacaagttatcaaaggctttcgccaagttggaatccaagttaacgaatgaaaaattcttt
ggtggtgatcagttagatatggtcgatattgcctggttacctttactgcatcgagcttca
attattgagcaacattctggctacgatttcattggtcagtttcccaaagtgaaagcactg
caaaaacagctgttggcaactggcttggctgagaaatcggtgtcagaagattttgaagag
aagtttgcagcattctatttgtcagagcaaacttatttgggacaatgtgccaaaactcaa
ctcgggaaaacttgttttggagagtctgattgtagagacgaagattttgactgttgttct
taa

DBGET integrated database retrieval system