KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1585Help
Entry
Lepto7376_1585    CDS       T02361                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61 2.7.13.3)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lepto7376_1585
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Lepto7376_1585
Enzymes [BR:lep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Lepto7376_1585
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Lepto7376_1585
Two-component system [BR:lep02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Lepto7376_1585
Bacterial motility proteins [BR:lep02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Lepto7376_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1794617..1798369
Genome map
AA seq 1250 aa AA seqDB search
MSLTDQFHKSRENFHVVGIGSSAGGLRTLEEFFEHMPNDSGAAFVVVQHLSPDFKSLMKE
LLERQTQMMVHQVENGMALEPNHVYLISPRNNLTLRDRHLYLVEQDSNLHSSQNFPINEF
FHSLAKNCREKAIGVVLSGTGNDGTEGLESIHNQGGMSLVQSPTSAEFDDMPQSAIAKGL
VDQVLPTQQLAQVIYDYVSLGKIDITKASLGERHLNVERVQDIITLLQESEDLEISDYKI
STLSHLIYRRASLAGSKDLTSYLNFLTISHEEKIFLKNDLQIFRLEDELQQTRKNLQTAI
QELEATNKEWQATKEALLASNEKLQNTNEELLSVNAELNTVNAEYQDTIAELTELSGDIN
NVLRSTYIGVVFLDSELCIRKFTHTATLAINLRETDIHRPLNHITHNLDFQDLTKPLLTV
LETEQPLESEVTLRDRPNIHLLMRIHPYITHLGECDGIVLSFVDISELKNIQTRLADSNN
FLEFLYRNAPVGLALFDQNLRWLRLNQEVADIDGVSISAHIGKTPREILPAIGDQVEALL
TQVIQTGEGLFNVSIHGITPADPHIERDWLANYYPVTFQNGDCGVGVVVTEITDLVQAKK
TIQEREGRLKYLQNACPGVIFTCQPTIVYRFNFISQNILDLVGFEGDRFFQDPDMWFNHI
ATQDQQTVIDSFHRKSPLNHIEHEYRFRCASGKNKWLAANLKLIRDDDGQPLEYVGFLLD
ISARKAAEADLRKQESLFRLTIDQSDITVFTQDLDLRYTWVYNPTIFKAKDILGRLDSDL
YSEAIATQLITHKQKILDSEQGDSLQIAINIDGCQRHFDLRLEPLMDSENRVIGLAGVSY
DITAEKEQQKKLAQQNVTLTEISQKTQAANIAKDEFLANMSHEIRTPMTAILGFTELLQE
ELKDHPDTAEYLQIIYSSADSLLVILNDILDLSKIEAGKLRLKYETFSLPQLFADMEKMF
IPKTNQKGLEFSMVVEESTPEFVVFDEVRLRQILFNLISNAIKFTNQGSVQVTASIHNVS
SEDSNLKLEIADTGIGIPVSDQERIFEAFTQREGQSTRNYGGTGLGLHITSRLTEMLNGI
ICLDSEVDRGSKFTLVFSNITFSNTINSGQSKEKSISPIANYLQQLNDLPQIKILCVDDN
ITNRLLLKSIFDQTKHSFFEAEDGQEGITMALKHKPDVILLDLLMPILNGAEAIARMKKM
SELKDIPIIILTAHTGDIPAEVTPHISGFIRKPFKSKSILKILRKIFSSV
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaactgatcagtttcacaaatcaagggaaaatttccatgtagttgggatcgga
tcatctgctggtggtttgcggacattagaagagttttttgaacacatgcccaatgatagt
ggggcagcttttgtcgttgtgcaacatttatcgcctgattttaagagcttaatgaaagag
cttttagaacggcagacacagatgatggtgcatcaggttgagaatggtatggcattggag
ccaaatcatgtgtatttgatttcgcctcgcaataatttaacgttgcgcgatcgccactta
tatttagtggagcaagactctaatcttcattcctcccaaaactttccgatcaatgaattt
tttcattccttagctaaaaattgtcgcgaaaaggcgatcggtgttgtgctctctgggaca
ggtaatgatggcactgaaggcttggaaagtatccataatcaaggggggatgagtttggtg
caatcgccgacatcagcagaatttgatgacatgccccaaagtgcgatcgccaaaggatta
gttgatcaagtattaccgactcaacagttagctcaagtgatttatgattatgtgtcgttg
ggcaaaatagatattactaaagcatctttgggagagagacatctcaatgttgaacgagtc
caagacattattactctcctacaagaatcagaagatttagagatttctgattacaaaatc
agcactttgtcgcatcttatttaccgccgtgcatcattagctggttccaaagacctaaca
agctatctcaattttctaacgatttctcatgaggaaaaaatctttttgaaaaatgacttg
cagatattccgcttggaggatgaactccaacaaactcgtaaaaatcttcaaacagccatt
caagagttagaagcgacaaataaagaatggcaggcaacgaaagaagcattactggcatct
aatgaaaagctgcaaaataccaatgaggaactcctctctgttaacgcagagctcaacacg
gtcaatgcagaataccaagatacaattgcggaactaacggagttgagtggagacattaat
aatgtcctacgcagtacatatataggggttgttttcctcgacagcgagttatgtatccga
aagtttacccatacagcaacgctcgccattaatttgcgggagacagatatccatcgtcca
ctcaatcacatcacccataacttagattttcaggatctgactaagcctttattaacagtt
ttagagacagaacagcccttagaatcagaagtcacattgcgcgatcgcccgaatattcat
ctcttgatgcgcatacatccctacataacccacctcggagaatgtgacggcattgttttg
agctttgtcgatatcagtgaacttaaaaatatccaaactcgccttgctgacagcaataat
tttctagagtttttatatcgcaatgcgcctgtcggattagcgttgtttgaccagaatctt
cgttggctgcgtctcaatcaagaggttgcagacattgatggggtttccatttcagcacat
attggcaaaacgccgagggaaatcttaccggcaattggcgatcaagttgaagcgctgcta
acgcaggtcatccagacaggagaaggattatttaatgtgtcaattcatgggataacacca
gcagatccacacatcgagcgggattggctggccaactattatcctgtgacgttccaaaat
ggcgattgcggtgtgggtgttgtcgttacagaaattacggatttggtgcaagcgaaaaaa
acaattcaagaacgtgaaggacgtttaaagtatttacaaaatgcttgccctggtgtgatt
ttcacttgtcaaccgacaattgtatatcgatttaattttattagtcaaaatattctggat
ttagtgggatttgagggcgatcgctttttccaagatcccgatatgtggttcaaccatatt
gcaacccaagatcaacaaactgttattgattctttccatcgaaaatctcccctcaatcac
attgaacatgagtaccgttttcgttgtgcatcgggcaagaataaatggctcgccgccaat
ctcaaattaatccgagatgacgatggacagcctttagagtatgtcggctttttactcgat
atcagcgctcgcaaagctgcggaagcagacctccgaaagcaagaatcacttttccgttta
actatcgatcagtctgacatcacagtatttacccaagatcttgatctacgctacacctgg
gtttataaccccacaattttcaaagcaaaagatattctcggcagattagattcggattta
tattctgaggcgatcgctacacaactcatcacccacaaacaaaaaattctggattccgaa
caaggtgattctttacaaattgcgatcaatattgatggatgtcaacgccactttgatctc
cgcctagaaccattaatggattcagaaaatcgtgtgattggactagcaggcgtaagctat
gacatcaccgcagaaaaagagcagcaaaaaaaattagcccaacaaaatgtcacccttaca
gaaatctcccaaaaaacccaggctgccaatattgctaaagatgaatttttagcaaatatg
agccatgaaattcgcacaccaatgactgcaattcttggctttacagaactcctacaggaa
gaactaaaagatcatccagatacagccgaatatctacagattatttactccagtgccgat
tctctattggttattctcaatgatatccttgatctttctaaaattgaagcagggaaacta
agactcaaatatgagacttttagcttgcctcaactcttcgcagatatggagaaaatgttc
atcccaaaaaccaaccaaaagggcttggaattttcgatggttgtcgaagaatccactcca
gagttcgttgtctttgatgaagttcgactgcgacaaattttatttaatctcattagcaat
gcgattaaattcaccaaccaaggctcagttcaggtcactgcatctattcataatgtgagc
tcagaagatagcaacctcaaacttgagatcgctgatacaggtatagggattccagtctca
gatcaagagcgtatttttgaagcctttacccagcgcgaaggacaaagtacaagaaattat
ggtggcactggcttaggactacatataaccagtcgtctcaccgaaatgttaaacggtatt
atctgtttagatagtgaggttgatcggggttctaaatttactttagttttctccaatatc
actttttcaaacacaataaattcgggacaaagcaaagaaaaaagtatttcaccgatcgct
aattatttacagcaactgaatgatttgccacagattaagattctatgtgtggatgacaat
ataaccaatcgtcttttacttaaatcaatatttgatcaaactaagcattctttttttgaa
gcggaagatggacaagaaggaataacaatggctttaaaacataagccagatgtaatttta
ttagatctactgatgccaatcctgaacggagcagaggcgatcgcccgtatgaaaaagatg
tcggaactcaaagatattcccatcattattttgaccgctcatactggagatattcctgcg
gaagttacccctcatatttcaggattcatccgtaagccttttaagagcaaatcgatccta
aagatcttgagaaaaatcttttcttcagtctaa

DBGET integrated database retrieval system