KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1625Help
Entry
Lepto7376_1625    CDS       T02361                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lep00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848942..1849847
Genome map
AA seq 301 aa AA seqDB search
MDIQQLNQDFGIDGSVRFTEERAGFPIIEIKNNFATAAISIYAAHVISYQPVNTDEDLIY
LSEDVIYKIGTALRGGIPICWPWFGPHPTDGSKPSHGVARKTFWQVSSTETTTTGATRVI
LKLTDSQESRALWDYRFELAIAVTVGETLNIELITRNTGDKAFDVTQALHTYFKIGNVDQ
VQVLGLDGCEYIDKVDGGEFKTQLGEVAIAAEVDRVYNDLPAELIIADPALNRKIHITSK
NSTTAIVWNPWINKSKALGDFPNEGYKQMICVETANAAKEVITVQPQSQYSITVEYRSES
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacattcaacaacttaatcaggattttggtatcgacggcagcgttaggtttaccgag
gagcgagcgggcttccccatcatcgagattaaaaacaattttgccaccgctgcaatttcg
atttatgccgcccatgtaatttcatatcaacccgttaatactgatgaggatctcatctac
ctgagtgaggatgtcatctataaaattggtacggctctacggggtggcataccaatttgt
tggccgtggtttgggccccatcccaccgatggcagcaagccgagtcatggtgttgcccgt
aaaaccttttggcaagtgagtagcaccgaaaccacgacaactggagcaacacgagtcatt
ttaaaattaactgattcacaagaaagtcgcgccctttgggattatcgttttgagctggcg
atcgccgtaacggtaggtgaaacgctcaatattgaattgattacccgcaacactggcgac
aaagcatttgacgttacacaggcattgcacacctatttcaaaatcggcaatgtcgatcaa
gtacaagtgctgggtttagacggttgcgaatatatcgataaagttgatggtggcgagttc
aaaacccaacttggtgaagtggcgatcgccgcggaagttgaccgagtttataacgatctc
ccagccgaactcatcattgccgatcctgccctcaaccgcaaaattcacatcacctcaaaa
aatagcaccacagcgattgtttggaatccttggataaacaagtcaaaagctctaggtgat
tttccgaacgaaggctataaacaaatgatttgcgttgaaacggccaatgccgccaaggag
gtgattactgttcaaccccaaagccaatattccatcacggttgaatatcgcagcgagtct
ttctaa

DBGET integrated database retrieval system