KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_2282Help
Entry
Lepto7376_2282    CDS       T02361                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lep00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lep00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2598568..2600061)
Genome map
AA seq 497 aa AA seqDB search
MQLGELLGQVSVIDSLPDHPALTQEVKGLVTNSKVVTTGDLFIGLPGTKVDGGEFWSGAL
DGGAIAAIVSADALEKVPTENGECVIVTSDPVIACAELANLFFENPTQSLKLVGVTGTNG
KTTTSHLIEFFLQQAKKNTALIGTLYTRWQGYEKIATHTTPFAIDLQKNFAKAVKAENTH
GVMEVSSHALDQKRVKGCEFDVSVFTNLTQDHLDYHKTMEEYFQAKALLFNDEYCKERAV
VNLDDQYGARLAHKLGEKCWGYSLQDKSAAIFMDRLEYTAIGVTGRLTTPEGTAQFSSPL
VGQFNLENVMAAIGAGLALGLDLEQMLTVLPEFTGVPGRMERVQVSDEQDISVIVDYAHT
PDSLENLLKASRPFIPRKMICVFGCGGDRDRTKRPLMGKIAATKSDWAVVTSDNPRTEDP
KRILVDVVEGIPEAIQFLVIPDRAAAIHQAILEAKPGDGVLIAGKGHEDYQILGTEKVHF
DDREEARKALGDRLKTS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaggtgaacttcttgggcaagtatcggttatcgactctctgccagatcatcct
gccctaactcaagaggtaaaagggcttgtcacgaattccaaagtggtaacgactggggat
ttgtttattggtttgccgggtacaaaagttgatggtggtgagttttggtcaggtgcttta
gatggtggggcgatcgccgcaatagtttccgcagatgccctcgaaaaagtgcctaccgaa
aatggtgaatgtgtcattgttaccagcgatccagtgattgcctgtgcagaattggctaac
ctcttttttgaaaacccgacccaatccctcaaactcgtcggcgtgacaggcacaaacggc
aagacgacaaccagtcacttaatcgaatttttcctccagcaagcgaaaaaaaatactgct
ctaatcgggacgctctacacccgttggcaaggttatgaaaaaattgcgacccataccacc
ccttttgcgatagacctccagaagaattttgcgaaagccgttaaagctgaaaacacccac
ggggtaatggaagtgagctcccatgccctcgaccaaaaacgagtgaaaggttgtgaattt
gatgtgtctgtattcactaatttgacgcaggatcacctcgattatcacaagacgatggag
gagtattttcaggcgaaagcgcttctctttaatgatgaatactgtaaagagcgagctgtt
gttaatctcgatgatcaatatggcgcaaggttagcccataaacttggtgaaaaatgttgg
ggatatagtctgcaagataagtcggctgcaatctttatggatcggttggaatatacggct
atcggagtgactggtcgtctcacaacgcctgaaggaacagctcaattttcgtcgccttta
gtcggtcaatttaacctcgaaaatgtgatggcggcgattggtgctggtttggcattgggt
ttagacctcgaacaaatgttgacagttttgccggaattcactggggttcccggtcggatg
gagcgtgtgcaggtatccgatgagcaggatatcagcgtgattgtggactatgcccatacg
cccgatagtctcgaaaatctactaaaggcctctcgtccgtttatccctcgcaaaatgatt
tgtgtgtttggttgtgggggcgatcgcgatcgcacgaagcgtccattgatgggcaagatt
gcggcaacaaaatctgattgggcggtggtgacttctgataatcctcgcaccgaagatccg
aaacgaattttggtagatgtcgtggaaggtattcccgaagcaattcagtttctcgtgatt
cctgatcgagcggccgccattcatcaagccattctcgaagccaaacctggagacggtgta
cttattgctggaaagggtcacgaagattatcaaattctcggcaccgaaaaagtccatttc
gatgaccgtgaagaggctcgtaaagctttgggcgatcgcctaaaaacatcgtag

DBGET integrated database retrieval system