KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_2492Help
Entry
Lepto7376_2492    CDS       T02361                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lep01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lep01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2798855..2799670
Genome map
AA seq 271 aa AA seqDB search
MTVATSQKLSLDWTTVIYFSLIHIVALLAFLPGNFSWQAVGVFLLFHWITGGVGITLGFH
RLVSHRSFDVPKWVEYILIFCGTLACQGGPLDWIGLHRIHHKHSDTTPDPHDSNKGFWWS
HIGWMLFEIPARADIDRYIKDIKDDPFYNFCQNYMIPIQVVVGLLLFAWGGWSFVTWGIF
MRLAVVFHCTWFVNSATHKFGYQSHESNDKSRNCWWVALVTYGEGWHNNHHAYQYSARHG
LNWWEVDMTWMTIRLLQILGLAKNIKLAPTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgctacctcacaaaagctatctctagactggacgactgtaatttatttcagt
ctcatccatatcgtcgcactgctcgcatttctgccaggcaattttagctggcaggcggtt
ggagtattcttacttttccattggattacaggcggtgttgggattacactcggattccac
cggcttgtctcccaccgcagcttcgatgtgccgaaatgggttgagtacattctgattttt
tgtggaacacttgcctgtcaaggagggcccctagactggattggtttacaccgtattcac
cataagcactcagacacgacccctgacccccatgattccaacaaaggattttggtggagc
catatcggttggatgctttttgaaattccagctcgcgcagatatcgatcgttatatcaaa
gatattaaagacgatcctttctataatttctgccagaactacatgattcctattcaagta
gttgtcggtttactactgtttgcttggggtggctggtcttttgtgacatgggggatcttc
atgcgcttagctgtcgttttccattgcacttggtttgtgaatagcgcaactcacaaattt
ggttatcagagccacgaatctaacgataaatcccgtaactgctggtgggttgccctcgtt
acttatggcgaaggctggcacaacaatcaccacgcctatcaatattccgcacgccatggt
ttgaactggtgggaagttgatatgacttggatgactattcgtttgcttcaaatcctaggt
ctagcgaagaatatcaaactcgctcctactgactag

DBGET integrated database retrieval system