KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_2600Help
Entry
Lepto7376_2600    CDS       T02361                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lep03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2903016..2903606)
Genome map
AA seq 196 aa AA seqDB search
MYTPPLARLIEQFQRLPGIGPKTAQRLALYILKRPEKDIEAFAQALLNAKKQVGVCQTCF
HLSATSICDICSHPKRQQDTICVVADSKDVIALEKTREYRGKYHVLGGVISPMDGIGPEQ
LTIQKLVQRASEDEITEVILAINPSVEGETTTLYIGQLLRPFVKVTRIAFGLPMGGDLEY
ADEVTLARALEGRREL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atttatacgccgccccttgcccgcctgatcgaacaatttcagcgtcttcccggcattggg
ccaaaaaccgcccagcgtctagctttgtatattctgaagcgtcccgaaaaagatattgaa
gctttcgcgcaggcactcctaaacgccaaaaagcaggtgggggtttgtcagacttgtttc
catctctccgccacgtctatttgtgatatttgtagccacccgaaacgacagcaggacaca
atctgcgtggtggcagactcaaaagatgtgattgccctcgaaaaaaccagagaatatcgc
ggtaaataccatgttctcggtggagtgatttcgccgatggatggcattggccccgaacag
ctcactatccaaaagctcgtacagcgtgccagtgaagacgaaatcacagaagtgattctg
gcgattaatcccagcgtcgaaggcgaaaccacaactttgtatattgggcagctcctgcga
cctttcgtaaaggtgacgcgcattgcgtttggtttaccaatgggtggcgacctcgaatat
gcagatgaagtaaccctcgcccgtgctctcgaaggtcgtcgcgaactatag

DBGET integrated database retrieval system