KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_3034Help
Entry
Lepto7376_3034    CDS       T02361                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lepto7376_3034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lepto7376_3034
   00052 Galactose metabolism
    Lepto7376_3034
   00500 Starch and sucrose metabolism
    Lepto7376_3034
   00520 Amino sugar and nucleotide sugar metabolism
    Lepto7376_3034
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lepto7376_3034
   00524 Butirosin and neomycin biosynthesis
    Lepto7376_3034
Enzymes [BR:lep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lepto7376_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3355434..3356315
Genome map
AA seq 293 aa AA seqDB search
MTDVIGIDLGGTGIKAGRFHMDGSCIEERQVATPQPSTPRAVAEAIAEIANELNADKQCR
AMGIGIPGPVDGTARIARVAINLSGWHDVPLADWIEEKTNLSVTLNNDANCAGLGEAWLG
AGRNHQNLILITLGTGVGGAIIINGKLFTGHYGAAGELGLITLNPDGPPCNSGNNGSFEQ
YCSINGVKRLSGHDPAELGRLAAKGDQEAIAHWEQYGALLGAGLTSLIYIFTPEMVILGG
GISASSDFFLPATRAEIKKRVLASSRVDLQLVKAELGNRAGMVGAAKLALQKL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtaattgggattgatcttggtggcacaggtatcaaagcaggccgctttcat
atggatgggtcttgtatcgaagagcgacaggttgccactccccaacccagtactccaaga
gccgtggcagaggcgatcgccgaaattgcaaatgaactcaatgcagataaacaatgtcgg
gcaatgggcatcggtattccagggccagtagatggcacagctcgtattgcacgggtggcg
attaatctcagtggttggcatgatgtgcccttagccgactggattgaggaaaaaactaat
ttatctgtgaccctcaataacgacgcaaattgtgccgggttaggcgaagcttggcttgga
gcaggtcgtaatcaccaaaatcttatattgattactctcggcactggtgttggtggcgcg
attattatcaatggcaaactcttcaccggacattatggtgcggcgggtgaactgggttta
atcacgctcaatcctgatggccctccctgcaatagtggtaacaatggttcatttgagcaa
tattgttcgattaatggtgtgaaacgtctatcgggtcatgaccccgctgaacttggacgc
cttgcagcaaaaggagatcaggaggcgatcgcccattgggagcaatatggtgcgttattg
ggtgctggcctaaccagtttgatttatatttttacgccagaaatggtgattttgggtggt
ggtatcagcgccagtagcgatttctttttacctgccaccagagccgaaataaaaaaacgt
gtccttgcttcatctcgcgttgatcttcagcttgttaaggcagaactcggtaaccgtgct
ggcatggttggagccgcaaaattagccttacaaaagctctga

DBGET integrated database retrieval system