KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_3290Help
Entry
Lepto7376_3290    CDS       T02361                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00260  Glycine, serine and threonine metabolism
lep00750  Vitamin B6 metabolism
lep01100  Metabolic pathways
lep01110  Biosynthesis of secondary metabolites
lep01120  Microbial metabolism in diverse environments
lep01230  Biosynthesis of amino acids
Module
lep_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lepto7376_3290
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lepto7376_3290
Enzymes [BR:lep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lepto7376_3290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon ADK_lid NinF
Motif
Other DBs
NCBI-ProteinID: AFY39516
UniProt: K9Q305
Position
complement(3632781..3634091)
Genome map
AA seq 436 aa AA seqDB search
MVQAPIDTAIKSLDTANFSQLTCKECGATYEAEAKHVCELCFGPLEVTYDYEKIKQKVSR
ETIEAGPNSIWRYKEFLPVETDTPIDVGTGMTPLLKANRLARRLGIKELYIKNDAVNMPT
LSFKDRVVSVALTRAQELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLESGKVL
GTLIYNPILMAVHGNYDQVNRLCSEVANSKGWGFVNINLRPYYSEGSKTLGYEVIEQLGW
ELPDHIVAPLASGSLFGKIYKGFNEFVKTGLVEDKDVRFSGAQAEGCSPISTAFKEGRDF
IQPQKPNTIAKSIAIGNPADGIYALEIARKTNGNIEDVTDAEIVEGMKLLAETEGIFTET
AGGTTIAVLKKLVEAGKINPDEKTVVYITGNGLKTQEAVQNAAGEPYTIDANLDSFEAAL
DRARTLERLDWQETSV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagcacccatagataccgccattaagtctttagacaccgctaacttctcacaa
ctcacttgtaaggaatgtggtgccacatacgaagcagaagccaagcacgtttgcgaactc
tgttttggccccctcgaagttacatacgactacgagaagattaagcaaaaggttagccgc
gaaacgattgaagctggccctaactccatctggcgctacaaagaatttttgcccgtcgaa
actgacacacccatcgatgtcggcacaggcatgactcctctcctcaaggcaaaccgctta
gctcgtcgcctcggtatcaaagagctttacatcaagaatgatgcggtaaatatgcccacg
ttgagctttaaggatcgcgttgtatccgttgctctcacccgtgcccaagaacttggtttc
tctaccgtttcctgtgcaagtactggtaaccttgccaactccactgcggcgatcgctgcc
cacgctggcctagactgctgcgtctttatcccttccgaccttgaatccggaaaagtcctc
ggaacgttgatctacaaccccattttgatggcggttcacggcaactacgaccaagtaaac
cgtctctgctctgaagttgcgaactccaaaggttggggctttgtgaacattaacctccgc
ccctactactccgaaggttccaagaccctcggttacgaagtcattgagcaactcggctgg
gaactccccgaccacatcgttgcgcctctagcttccggttcactcttcggcaagatttac
aaaggctttaatgaattcgttaaaactggcctcgtcgaagacaaggatgtccgcttcagt
ggtgcccaggcagaaggatgttctcctatctcgacagcatttaaagaaggtcgcgacttc
atccaacctcagaagcccaacaccatcgcaaaatccattgcaatcggtaatcctgctgac
ggtatctacgctcttgaaattgctcgcaagactaacggcaacatcgaagacgttactgat
gcagaaatcgttgaaggcatgaagctcctcgctgaaactgagggcatcttcactgagact
gctggcggtacaacaatcgcagtgctcaagaagctcgttgaagctggcaaaattaatcct
gacgaaaagactgttgtgtacatcacaggtaacggtctcaaaactcaggaagcagttcaa
aatgcagcaggtgagccttacacaatcgatgcgaaccttgattccttcgaggctgctctt
gaccgtgcccgcacccttgagcgcttagattggcaagaaacttctgtataa

DBGET integrated database retrieval system