KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_3371Help
Entry
Lepto7376_3371    CDS       T02361                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lepto7376_3371
Enzymes [BR:lep01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Lepto7376_3371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3717540..3719591
Genome map
AA seq 683 aa AA seqDB search
MPTLTTSRTSFPLTAVVGQDVIKTALLLGAVDPALGGVAIAGKRGTAKSVMARGIHSLLP
PIEIIKDNPYNCDPTNPSDWDDLTALEFNGTNPENIPTEVIAAPFVQIPLGVTEDRLLGS
VDVEASVRQGEPVFQPGLLAQAHRGVLYIDEINLLDDQIANQLLSVLTDGRNQIEREGIS
FSHPCRPLLIATYNPEEGDLREHLRDRIAITLSADRPLLLEERVAAVEQVVQYSESPKEF
LASYEDDLDALRTQIILAREWLKEVNITTDQVAYLVNEAVRGTVEGHRAELFAVRVAMAA
AALDGRNIVTADDLRTAVELVILPRATTIPTPEDDDMQPPPPPPPQSQDEDDDDQSSDDD
QDDEDQDDDDQDEDQEEQPEQEPTIPEEFIFDPEGVVLDPNILAFAQMMQNKSQGSSGKR
GLIFSDDRGRYIKPMLPRGKVRRIAVDATLRAAAPYQKARRAKYPGRNVIVEQGDLRSKR
MARKAGSLIVFLVDASGSMALNRMNAAKGAVMRLLTEAYENRDQIALIPFRGEMAEVLLP
PTRSITLAKNRLETMPCGGGSPLSHGLTQAVHVGMNAKMSGDVGDVVIVAITDGRGNIPL
ARSLGEVPEEGEAKPDIKEELLDIAGKIRASGTKLLIIDTEKKFISSGFGKELAKQAGGK
YYRLPKATDQAIASMAKGAMAEI
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcctactttaacgacatctcgaacatctttccccttgacggcggttgtcggtcaggat
gtgattaaaacagcccttctgctcggtgcggttgacccggctctgggcggggtggcgatc
gccggaaaacgcggcacggctaaatcagtgatggcgcggggcattcattcattgttgcca
cctatcgaaattattaaagataatccatacaattgtgatccgactaatccaagtgattgg
gatgatctaaccgcactcgaatttaatgggacaaatcctgaaaatattccgacagaagtg
attgcggctcccttcgtgcaaattcctttgggagtcacggaagatcgcttacttggttct
gttgatgtcgaagcttcagtacggcaaggtgaacctgtatttcaacccggacttttggcg
caggcacatcgaggtgttctctacattgacgaaattaatcttctcgatgatcagattgcc
aaccaacttttaagcgtgctgactgatggtcgtaaccaaattgagcgggaaggcattagt
ttttcccacccttgtcgtccgctattaattgccacctataaccccgaagaaggtgatctc
agagaacatttgcgagatcgcatcgccattactctctccgctgatcgtcctttgctcttg
gaagaaagagtagctgccgtagaacaagtggtgcaatactctgaatcacccaaagaattt
ttagcatcctacgaagatgatctagatgccctgcgaactcaaattattttggcgcgggaa
tggctcaaggaagtaaatatcacaacagatcaagtagcctatctcgtcaacgaagcagta
cgaggtacggtcgaaggtcatcgggcagaactttttgcagttcgggtcgcaatggctgca
gctgctttagatggtcgcaatatcgttacagcggacgatttgcggactgccgtggaattg
gttattctaccgcgtgcaacaacgattcccacgccggaagatgacgatatgcagccacca
cctccgcctccaccacaatctcaagatgaagacgatgacgatcagtcttctgacgatgat
caggatgatgaagatcaagacgacgatgatcaagatgaagatcaggaagagcagcccgaa
caggaaccgacaattcccgaagaatttatctttgatccagaaggggtcgtcttagatcct
aatatccttgcttttgcgcagatgatgcagaacaagagtcaaggtagttctggtaagcgg
ggtctaattttctctgatgatcgtggccgttatatcaagccaatgttgccacgaggtaaa
gttcgtcgtattgcggtggatgcaaccctaagagctgcggcaccttaccagaaagctcgt
cgtgctaagtatcctggtcgtaacgttatcgttgaacaaggcgatttgcgctcaaagcga
atggctcggaaagcaggttcattaattgttttcctcgtagatgcgtcgggttctatggcc
cttaaccgaatgaatgcagcaaaaggtgcagtgatgcgtcttttgacagaagcctatgaa
aatcgtgaccaaattgcattgattccgttccgtggtgaaatggcggaggttctattacca
cccacacgttcgattaccctcgctaaaaaccgtctggagacgatgccttgtggtggtggt
tcaccgttatcacatggtttaactcaggcggttcatgttggcatgaatgcgaaaatgtct
ggtgatgtcggtgatgtcgttattgtggcgattaccgatggtcgtggcaatattccatta
gcgcgttctttgggtgaggtgccggaggaaggcgaagcgaaaccagatattaaggaagaa
ctccttgatattgcagggaaaatccgtgcttctggtacgaaactcttgattatcgatacg
gagaaaaagtttatctcttctggttttggtaaggagttggctaagcaagcaggcggtaaa
tattatcgtctgcccaaagcaacggatcaggcgatcgcctccatggcaaaaggagcaatg
gccgaaatctaa

DBGET integrated database retrieval system