KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_3406Help
Entry
Lepto7376_3406    CDS       T02361                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lepto7376_3406
Enzymes [BR:lep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Lepto7376_3406
Exosome [BR:lep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lepto7376_3406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3751142..3753466)
Genome map
AA seq 774 aa AA seqDB search
MPTVTTSEQVHQIVSNHHDNPHTILGHHSIELGGTMTWLVRTYLPRAEQAWVIDPVSQKE
YPMTSVHNPNFFECILEQELPPQYKLKYKSGDDYFTIYDPYEFVEAPHISDLDLHLFAEG
NHHRIYDKLGAHLLNIKGIEGVYFSVWAPNARNISVIGDFNNWDGREHQMRKLGVGVWGI
FIPELGVNTQYKYEIKNYEGHIYEKSDPYGFFQEVRPNTASIVADLDQYEWNDEAWLKQR
EASDPLKQPVSIYELHLGSWLHASAEEPMALLSGEVAPIPVNETKEGARYLSYYELVDKL
IPYVVEMGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGRPEDLMYFIDQCHANGIGV
LVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLIFNYNRNEIRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYDREDGEWLPNDYGGNEHLEAVDFLRQTNNLIFKYYPG
VISVAEESTAWPMVSRPTYLGGLGFNLKWNMGWMHDNLSYFSTDPWFRQHNQNSITFSMW
YHFSENYMLALSHDEVVHGKSSILGKMPGDDWQKFANVRALFTYMFMHPGKNTMFMSMEF
GQWNEWNVWTDLNWDLLDHEPHAKLKSFFAALNAFYKEQPALYELDFEEEGFDWIDCSDN
QNSVVSFVRRAKDPKDFLVVVCNFTPQLHPHYRVGMPEAGCYDEVFTSDMETFGGSNNKN
FGGVWTEEWGMHGQPYSADLCLPSLGVVVLKINRERTAEAIASQQSQTESHSLT
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgcctactgtgactacatctgaacaagttcatcagatcgtttcaaaccaccatgacaat
ccccatactattttgggccatcactccattgaattgggcggaacaatgacatggttggtg
cgtacctatctgcctagagctgagcaggcttgggtcatcgatccagtatcacaaaaggaa
tacccgatgacatcggtgcataatccaaacttttttgaatgtattcttgagcaagagtta
ccgcctcaatacaaactgaaatacaagtctggcgatgactatttcacgatttatgatcct
tacgaattcgtcgaagccccccatatcagcgacctagacctccacttattcgccgaaggc
aatcaccaccgcatttatgacaagctcggcgcacatctcctcaatatcaaaggtatcgaa
ggtgtctacttttctgtttgggcacccaatgctcgcaatatctccgtcattggtgacttt
aataattgggatggacgcgaacaccaaatgcgcaaacttggcgtcggtgtttggggcatt
ttcatcccagaactaggtgtcaacacccagtacaaatacgaaattaagaactacgaagga
catatctacgaaaaatcagacccctacggttttttccaagaagtccgacccaatacagct
tctatcgtcgcagatctcgaccaatacgaatggaatgatgaagcttggctcaaacagcgt
gaagcgagcgatccactcaaacaaccggtctccatttatgaattacacctaggttcttgg
ctacatgcctccgcagaagaaccaatggcattgctctctggtgaagtagctcctattcct
gtcaacgaaacaaaagaaggagcacggtaccttagctactatgaactagtagataagctc
attccatatgtcgtagaaatgggctatacccatatcgagctactaccgattgcggagcat
ccctttgatggttcttggggttatcaagttaccggctattatgcaccgacctcccgtttt
ggtcgtcccgaagacttgatgtactttatcgaccaatgtcatgcgaatggtattggtgtt
ttggtggactgggttccgggccacttcccaaaagacggtcatggcctagcgtttttcgat
ggcacacatctttatgaacatgcagatcctcgcaaaggtgagcataaagaatggggaact
ttaatctttaattacaaccgaaatgagatccgtaacttcctcgttgcgaatgctttattt
tggtttgacaaatatcatatcgatggcattcgggtagacgcagttgcatctatgctttac
ctcgactatgaccgtgaagatggagaatggttaccgaatgattacggtggtaatgagcat
ttagaagcagtcgatttcctccgtcaaacaaataacctgattttcaagtattatcctggc
gtcatttctgtggcagaagagtccacagcatggcctatggtgtcacgtcccacttatctc
ggtggcttaggctttaacctcaaatggaatatgggttggatgcatgacaacttgagttat
ttcagtacagatccctggttccgtcagcataatcaaaacagcatcaccttcagcatgtgg
tatcacttcagcgaaaactatatgttggcgttgtcccatgatgaagttgtccatggcaag
agttcgattcttggcaaaatgcctggagacgactggcaaaagttcgcaaatgttcgagca
ttgtttacttacatgtttatgcatccgggtaagaacacaatgtttatgagcatggagttt
ggccagtggaatgaatggaatgtctggacagatctaaattgggatttgctcgatcatgaa
cctcatgcgaagttaaaaagtttcttcgctgccttaaatgctttttataaggagcaacca
gctctctatgagctagattttgaggaagaaggtttcgactggattgattgctcagataat
caaaatagtgtagtttcatttgttcgccgggcaaaagatcctaaagactttttagttgtg
gtttgtaatttcacaccacagttacacccgcattaccgggttgggatgcccgaagcgggc
tgctatgacgaggttttcacaagtgatatggagacgtttggcggcagtaataacaaaaac
tttggcggagtctggactgaagagtggggaatgcatggtcagccttactctgccgatttg
tgtttaccatcacttggcgtggttgttcttaaaattaatcgtgagcgcacagctgaggcg
atcgcctcccagcaatctcaaactgaatcacactctctcacctaa

DBGET integrated database retrieval system