KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_3439Help
Entry
Lepto7376_3439    CDS       T02361                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lep00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3786553..3788976)
Genome map
AA seq 807 aa AA seqDB search
MKLLVQPPSIPDCAWQRPIGLGWENPYTVRYASNLDDGPWHGMPLGGFGAGCIGRSPRGD
FNLWHLDAGEHTFRNAGACQFGVYEYVEGGEAQAYAMATEPPDDGTLESWDWYPTEKGTY
SALYPRSWYEYKDVFNVELTCEQFSPIVAESYQETSYPTAIFEWSAHNPTDKPITVSIMM
SWQNMVGWFTKATKTPKVELRDDGSPVYEYQSRWGDSTGNLNQWIQDRYRVGCLLTRVRP
HDQISEGEGQICFATVTNPTLEVFYHNRWNPSGDGRDVWNYFAGNGSLPDVEDETPASPG
EQIAGAIAVRFTVRPGRTKKIPFFLAWDFPVMEFAPNITYFRRYTDFFGRSGHNVWSIIR
TAMKHSDLWKERIEEWQKPFLSRADLPDWFKMSLCNELYLLAQGGSLWTAATEDDPVGQF
GVLECLDYSWYESLDVRMYGSFALAMLWPKLDKSVLEAFARAIPSSDDTQRAIGYNKLMG
YDNFMAARKRAGATPHDLGAPNEHPWEATNYTAYQDCNLWKDLGADFVLQVYRDFVMTGS
KDTEFLWSCWEGVVQALDYLKTFDLDCDGIPENGGSPDQTFDDWKLKGISAYCGGLWIAA
LEAAIAIANILKNKASIYEEHQNQVSTEEFEAAIAKYQDWLKQSRPLYQDTLWNGSYYTL
DTGSDSKVVMSDQLCGEFYTQLLNLPNVNPENRTAITLQTIYEACFLKFHDGQFGAANGL
NPDGSPEKENDTHPLEVWTGINFGIAAFMIRNGMKDEALKMTEAVIHQVYSNGLQFRTPE
AITANNTFRACHYLRAMGIWAIYDALT
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacttgtgcagcccccgtctattcccgattgtgcatggcaacgtcccattggg
ttaggttgggaaaatccctatacggtgcgttacgcgagtaatctcgatgatgggccgtgg
catgggatgcctctcggtggatttggggctggctgtatcgggcgatcgccacgcggtgat
tttaatttatggcatctggacgcgggagagcatacttttcggaatgctggcgcttgtcaa
tttggtgtctatgaatatgttgagggcggcgaagctcaagcctatgcaatggcgacggag
ccacctgatgatggcacgctagaaagttgggattggtatcccacagagaaagggacatat
tcagcgttatatccccgcagttggtatgagtacaaagatgtttttaatgttgagctaacc
tgcgagcagttttcgcccattgtcgcggaaagttatcaagagacaagttatccaacagct
atttttgaatggtctgctcataatcccaccgataagccaattacggtcagcattatgatg
agttggcagaatatggtcggctggtttacgaaagcaacaaaaacgcccaaggttgagcta
cgagatgacggttcaccagtttatgaatatcaatcccggtggggtgatagcacaggtaat
ctcaatcagtggattcaagatcgctatcgagtgggatgtctattaacgcgtgtgcgtccc
cacgatcaaattagtgaaggggaagggcaaatttgttttgcaacggtgaccaatccaacc
cttgaagtcttctatcacaaccgttggaatccgtcgggtgatggtcgtgatgtttggaat
tattttgcgggcaatggttcgctacccgatgtcgaagatgaaacgccagcctcccccggt
gaacaaattgctggggcgatcgccgtgcggtttacggttagacccggtagaacgaaaaag
attccatttttcctagcatgggattttccggtgatggaattcgcgccaaacattacttat
tttcgacgttataccgacttctttgggcgtagtggccacaacgtctggtcaattattcgc
actgcaatgaagcatagtgatttgtggaaagagcgcatcgaagagtggcaaaagcctttt
ctgagtcgtgcagatctaccagattggttcaaaatgtcgttgtgcaatgaattgtattta
ttggcacaaggcggcagtctttggacggcggcgacagaggatgatccggtaggtcaattc
ggtgtgttggaatgcctagactattcttggtatgaaagcctcgatgtgcgaatgtatggc
tcttttgcgttagcgatgttgtggccaaaattagataaatctgtgttggaagcattcgcc
cgcgccattccgagtagtgatgatacccagcgagcaattggctacaacaaattaatgggt
tacgacaatttcatggctgcccgtaaacgtgctggggcaacgcctcatgacctcggtgcc
ccgaatgaacatccttgggaagcaacaaattacacggcatatcaagattgcaatctctgg
aaagatttgggggcagattttgtcttgcaggtttatcgtgattttgtgatgacaggctcg
aaagatacagagtttctctggtcttgttgggaaggggtcgttcaggcgttagattacctc
aaaacatttgacttagattgtgacggcattcccgaaaatggcgggtcacctgaccaaaca
tttgatgactggaaactgaagggcattagtgcttattgtggtggtctttggattgcagct
ttagaggcggcgatcgccattgcaaatatcctaaaaaataaggctagcatctacgaagag
catcaaaatcaagtgagtactgaggaattcgaggcggcgatcgccaaataccaagattgg
ctcaaacaatcccgaccgctttaccaagatactctctggaatggcagctactacaccctt
gatacaggcagtgattctaaagttgtgatgtcagatcaactctgcggtgaattttatact
cagcttttaaacttgccgaatgtcaatccagaaaatagaacagcgataaccttacaaacc
atttatgaagcttgttttctcaaattccatgatggccaatttggtgcggctaatggtcta
aatcctgatggctcccctgaaaaagaaaacgatacccatcccctcgaagtttggacaggc
attaactttggcatcgcggcctttatgattcggaatggtatgaaggatgaagctttaaaa
atgactgaagcagttatccatcaagtctattcaaatggtttgcagttccgtacccctgaa
gccattactgccaacaatacttttcgggcttgccattaccttcgggcaatgggaatttgg
gcgatttatgatgcattaacttaa

DBGET integrated database retrieval system