KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_4169Help
Entry
Lepto7376_4169    CDS       T02361                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4640051..4641589
Genome map
AA seq 512 aa AA seqDB search
MFDRRVSGVLLHPTSLPGRFGIGDLGAEAYRFIDFLAKGGQQIWQVLPLGPTGFGNSPYL
CYSAFAGNPMLINLEWLASEGLLDQSDLDNAPEFSETGLDYSKAIAFKMPLLKKASEKFR
TSATADRKEAFIEFCEDQTYWLDDYALFMAIKEANDGKSWFQWEPKLAWRETEAIALKRE
ELKEAIFFHKYIQSEFFRQWSSLKEYANGKGIQIFGDLPIYVAHDSADVWGHPKIFRLDY
KTGAAKWMAGVPPDYFSETGQLWGNPVYNWRNLARTNYAWWIERVKTMLAFVDIIRVDHF
RGFEGFWAVPRGEKTAMNGRWVGAKGDEFFQILKDTLGDLPIVAEDLGVITPEVEALRDK
YKLPGMKILQFAFDSDRANPFLPFNYVNRNCLVYTGTHDNDTTVGWFDKRTEEEKSRVTD
YLGCVGEEGIHWALIRLAMGSVANIAIFPLQDLFGLGTDAKMNTPGIAAGNWEWRYDAAS
LSDDLIWKFRSVTYMYGRDSGYEEPQEEWAES
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatcgtcgtgtcagtggtgtattgctgcatccgacctcccttcctggacgtttt
gggattggagatttaggggcggaagcctatcgttttattgattttttagcgaagggtggt
cagcagatttggcaagttttacccctaggcccgacaggtttcggaaattctccctatctt
tgttattcggcgtttgcgggtaacccgatgctcattaaccttgagtggttggcatctgag
ggtttattagatcaaagcgatctggataatgcaccagaattttcggaaactggacttgac
tatagtaaggcgatcgcctttaaaatgcccctcctcaaaaaagccagtgaaaagtttcgc
acatcagcgacagcggaccgtaaagaagcctttatcgaattttgtgaagatcaaacctat
tggctcgatgactatgcgctatttatggcaattaaagaagctaatgacggtaaatcttgg
tttcagtgggagccgaaattagcatggcgcgaaactgaggcgatcgccctgaaacgagaa
gaattaaaagaagccattttcttccataaatatattcaatccgaatttttccgacaatgg
tctagcttgaaagagtacgccaatggcaaaggaattcaaatctttggcgatctgcccatt
tatgtcgcccatgacagcgctgatgtgtggggacatccaaaaattttccgcctcgattac
aaaacaggtgcagcgaaatggatggctggtgtaccacccgactactttagtgaaaccgga
caactctggggaaatcccgtttacaactggcgcaacctcgcccgcaccaactatgcctgg
tggattgaacgagtgaaaacaatgttggcttttgtcgatattattcgtgttgatcacttc
cggggctttgagggattttgggctgtgcccagaggcgaaaaaaccgcgatgaatggtcgt
tgggtcggtgccaaaggcgatgaatttttccaaattctgaaagatactctcggtgacttg
ccgattgtggctgaggatctcggtgtgatcacaccggaagtagaagcattacgagataag
tacaaacttcccggcatgaaaattctgcaatttgcctttgatagcgatcgcgccaaccct
ttcctaccctttaactacgtcaaccgcaattgcctcgtttacactggcactcacgataat
gacactactgtgggttggtttgacaaacgtaccgaggaagaaaaatctcgggtcacagat
tacctcggttgcgttggtgaagaaggtattcactgggccttaatccgcttagcaatgggc
tctgtagcaaatatcgccattttccctttacaagatttattcgggctagggacagacgcc
aaaatgaatacccctggcatcgccgctggcaactgggaatggcggtatgatgcggcttct
ctctcggatgatttaatttggaaattccgatctgtgacttatatgtatggtcgtgattcc
ggctatgaagaaccgcaggaagaatgggccgaatcctaa

DBGET integrated database retrieval system