KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_4426Help
Entry
Lepto7376_4426    CDS       T02361                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lepto7376_4426
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lepto7376_4426
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lepto7376_4426
Enzymes [BR:lep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lepto7376_4426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4946490..4947605)
Genome map
AA seq 371 aa AA seqDB search
MVLSTPALDLSNQVFPTQPAAQWPGLIEAYRQYLPVTESTPVVTLLEGNTPLIPIPSIAA
EIGRDVQVYAKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRA
GLRAFVLIPDGYVALGKLAQALLYGAEVIAIEGNFDDALSIVQQMSESYPVTLVNSVNPY
RLQGQKTAAFEVVDNLGDAPDWLCIPVGNAGNITAYWMGFCEYHELNKTTKLPKMMGFQA
AGAAPFIQGGPVKNPETFATAIRIGNPVNWDKAQGVRAASQGEFNAVTDEDIVEAYRKLG
GNEGIFCEPASAASVAGLLKVKDRVPDGAKVVCVLTGNGLKDPDSAIAHSLSKGQTGIPA
NIEAVAKAMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggttctgagtactcccgcattagatttgagcaaccaagtatttccaacccagcctgcc
gctcaatggcctggtttgatcgaagcatatcgacaatatctccccgttacagagagcacc
ccggtcgttaccctcctcgaaggcaacactcccctcattccaattccgagtattgctgct
gaaattggtcgtgacgtacaagtttatgcaaaatacgacggcctaaaccccactggtagt
ttcaaagatcgcggcatgactatggcgatcaccaaagccaaggaagctggggcgaaagcg
gtaatttgtgcaagtactggaaatacatctgcggctgcggctgcttatgctcgtcgtgcg
ggattacgcgcctttgttttgattcctgatggttatgttgcgcttggtaaattagcccaa
gccttgctttatggtgctgaagtaattgccatcgaagggaactttgatgatgcgctcagt
attgttcagcagatgtctgaaagttatcctgtcacccttgtaaattcagttaatccctat
cgcttgcaaggtcagaagaccgctgcttttgaagtggttgataatcttggtgatgcacct
gattggctctgtatccccgttggtaatgcgggtaacattacagcttattggatgggtttc
tgtgaatatcatgaactgaataagacaacaaaactcccgaagatgatgggtttccaagcg
gctggagctgcaccgtttattcaaggcggtcccgtcaaaaatcctgagacatttgcaaca
gcaatccgcattggtaatccagtaaactgggacaaagcccaaggcgttcgggcagcgagt
caaggcgagtttaacgcggttacagatgaagacattgttgaggcttaccgaaagcttgga
ggcaatgaagggattttctgtgaacctgcgagtgccgcttctgtggcaggtctattaaaa
gtgaaggatcgcgtacctgatggcgctaaggttgtttgcgtcctaacgggtaatggtctc
aaagatccagattcggcgatcgcccacagtttgagtaaaggtcaaactggaattcctgcg
aatattgaagccgttgcgaaagcgatgggattttag

DBGET integrated database retrieval system