KEGG   Legionella fallonii: LFA_0040Help
Entry
LFA_0040          CDS       T03771                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lfa  Legionella fallonii
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:lfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LFA_0040
   00630 Glyoxylate and dicarboxylate metabolism
    LFA_0040
   00640 Propanoate metabolism
    LFA_0040
   00650 Butanoate metabolism
    LFA_0040
  Lipid metabolism
   00071 Fatty acid degradation
    LFA_0040
   00072 Synthesis and degradation of ketone bodies
    LFA_0040
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LFA_0040
   00310 Lysine degradation
    LFA_0040
   00380 Tryptophan metabolism
    LFA_0040
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LFA_0040
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LFA_0040
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LFA_0040
Enzymes [BR:lfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LFA_0040
Exosome [BR:lfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LFA_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(41571..42845)
Genome map
AA seq 424 aa AA seqDB search
MSFGKKVAILGSSRTPFVKSQTQYLGKSNQDLLGTALANLIDKTHIQGQLLGDLVAGAVM
NHPFDWNLAREVILGSTLSPDTPGLTIQRACGTGLESINIIALKIASGQIAVGIGGGTDT
NSDIPLIGQRTLTHFLIKYKQAKGFKERFAVLKKFRFNMLKPLLPEVREPRTKLSMGEHC
ELMVKEWQISRQAQDELALHSHHNAALAYDEGFYDDLIVPVAGLKRDGITRKDTTLQKLA
GLKTVFDRSDKGSLTAGNSTPLTDGAALVLLGSPQWAKTHNLDILAYFVDCEVAAVDFVH
GAGLLMAPTIAVNRLLARNKLSLQDFDYYEIHEAFAGQVLCTLKAWESADYCQKVLGRDQ
PLGSIDLQKMNVKGGSLALGHPFAATGGRIIGAAAKILANKEKGRLLISICTAGGMGVAA
IIER
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagttttggtaaaaaagtagctatccttggcagttcgcgtaccccatttgtcaaatcg
caaacccagtatttgggaaaatcaaatcaagacttattagggactgccttagctaatctg
attgataaaacgcatattcaaggtcaattattaggtgatttagttgctggtgcagtaatg
aatcatccttttgactggaaccttgctcgagaggtgatattaggcagcaccctatcgcca
gacacacctggtttaacaattcaacgagcctgtggcacgggactagagtccatcaatatc
atcgccttaaaaattgcaagtggccaaattgctgtagggataggtggcggaacagatacc
aattctgacattccccttattggtcaaagaacactgacgcattttttaatcaaatacaaa
caggcaaaagggtttaaagaacgctttgctgtgcttaaaaaatttcgtttcaatatgtta
aaaccattattgcctgaagtgcgtgagcctaggactaagctgtctatgggagaacattgt
gagctcatggttaaggaatggcaaattagtaggcaggctcaagatgagcttgccctacat
tctcatcacaatgctgccctagcttacgatgagggcttttacgatgatttaattgttccc
gttgcaggcttaaaacgcgatggcattacccgtaaggacacaaccttacaaaaacttgct
ggattaaaaaccgtttttgatcgctctgataagggtagtttaactgcagggaactcaact
cctttaacagatggtgcagcattagtgcttttaggctctccccaatgggctaaaacccat
aatttggatattctcgcctattttgttgattgtgaggtagctgctgtggattttgttcat
ggcgccggcctattaatggcacctactatagcggtaaaccgcttattagcaagaaacaag
ctaagccttcaagattttgattactatgaaattcatgaagcctttgcagggcaggtgctt
tgtacgttaaaagcctgggagtctgccgattattgccaaaaagtactaggccgagatcaa
cctttaggtagtattgatctacaaaaaatgaacgttaaaggaggcagccttgctttagga
catccctttgcagcaacaggggggcgtatcattggcgctgcagcaaaaattttagcgaat
aaagagaaaggtcggttattgatcagtatatgtactgccgggggtatgggggtagctgca
attattgagcgttaa

DBGET integrated database retrieval system