KEGG   Leptospirillum ferrooxidans: LFE_0042Help
Entry
LFE_0042          CDS       T01809                                 

Definition
pyruvate synthase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFE_0042
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_0042
   00020 Citrate cycle (TCA cycle)
    LFE_0042
   00620 Pyruvate metabolism
    LFE_0042
   00640 Propanoate metabolism
    LFE_0042
   00650 Butanoate metabolism
    LFE_0042
  Energy metabolism
   00680 Methane metabolism
    LFE_0042
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFE_0042
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFE_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(49263..50270)
Genome map
AA seq 335 aa AA seqDB search
MEDLPTKNISLTLLREQQPRFTGLEAGHRACQGCGQALAARLVLEAAGPDTIIANATGCL
EIFSSSWPESAWRTPWIHSLFENTAAVASGIEAAMRAQGRSTRVLAFAGDGGTFDIGFQS
LSGMLERNHSVLYVCFDNEAYMNTGVQRSGSTPHGAWTTTSPVGSRTRGKKHYKKDLLSI
IAAHRIPYSATASIAYPSDLRSKVRKALGEEGSSFILIHSPCPLGWGHESHLAIEIDRLA
VETGLFPLIEMEGGELTHVMPIRKKRPVIDYIRPQERFRHLLEESDKAEEERNHLQALCD
FNIERYGLLLSSPEPSSRLDSQSADTVRRGGGRWT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaagatctgcccacaaagaacatttcactcactctccttcgtgaacagcagccgagg
tttacagggcttgaagcaggacatcgggcctgccagggttgcgggcaggccctggccgcc
cgattggtcctcgaagccgctggtccggatactattatcgcgaacgcaaccggatgcctg
gaaatcttcagctccagctggcccgagtccgcatggagaacgccgtggatacactccctg
tttgaaaacactgccgctgtcgcttccggcatagaagccgccatgagagcccagggacga
tccacacgggttctggctttcgccggagatggaggaacttttgatatcggatttcagtca
ctgtccgggatgctggaacgaaatcactcggttctttatgtctgcttcgataatgaagct
tatatgaatacaggcgtccaacgctcaggctccaccccacacggagcctggacaacaacc
tcccccgtcggctcccggaccagagggaaaaaacactacaaaaaagatcttttgtctatt
atagcggcccaccgcattccgtattctgcgacagcctcaatcgcctatccttccgatctt
cgatcgaaggtcagaaaagcgctcggagaagaaggatcctcatttatcctgattcattct
ccctgccctctggggtggggacatgaaagccatctggccatcgaaatcgatcgtcttgcc
gtggaaacaggactctttccactcatcgaaatggagggaggagagttgacacatgtgatg
cccatacggaaaaaacgccctgtcattgactacataaggccacaagaacgtttccgccac
cttctcgaagagtctgacaaggcggaagaagagcgaaaccacctccaggctctatgcgac
ttcaatattgaacgatacggattgctgctgagctctcccgaaccatcttcccgccttgat
agccaatccgcagacactgtcagaagaggcggcgggcgatggacatga

DBGET integrated database retrieval system