KEGG   Leptospirillum ferrooxidans: LFE_0043Help
Entry
LFE_0043          CDS       T01809                                 

Definition
pyruvate ferredoxin oxidoreductase, alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lfc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lfc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lfc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lfc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lfc00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:lfc00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:lfc00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:lfc00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50289..51497)
Genome map
AA seq 402 aa AA seqDB search
MLEALEGSQAIARAVALCRPQVVAAYPITPQTHIVEAISRMIANGILSAQYISVESEFSA
ASVVMGASAAGSRSYTASASQGILLMTEVLYNTAGLRIPTVLTVANRAVSAPLSIWNDHQ
DSMSVRDAGWIQLYCANNQEAVDTTIQAFLISEKTEIPVMVCVDGYTLTHTLEPVDLPDQ
GQIDTFLPPFHFRRTLDSQSPIMVGTIVSPDFYTEARYINHQDFEKALTVIKETDEIYFH
LTGRRSGALLSVTGNRNGRTGILLMGSVFGTLTDALSSHEGKEDIRLLKLRSFRPFPQKE
LQEAVHGLRTLIVLDRSISPGGGAGIVGMEVRSALFGQKDAPRIINAVVGLGGRDLPMSL
LRQLVDLSKKTDAPEFLFADLEPSRITRELSPLNRTNTSEER
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagctcttgaaggatcccaggccattgccagggcggtggccctgtgtcgccca
caggtcgtcgcagcttacccgatcactccccaaacccatattgtggaggcaatttcaaga
atgatcgcgaacggcatcctttccgcacaatatatcagcgtggaaagtgaattttccgca
gcatctgtcgtcatgggcgcttcggctgccggttcccgttcctacaccgcaagcgcctct
cagggaatccttctgatgacggaggttctctacaacactgccggcctccggatccccacc
gtactgaccgtcgcaaaccgtgccgtctctgcccctctttccatctggaatgaccatcag
gattcaatgtccgttcgtgacgccggatggatccagctctattgcgccaataatcaggaa
gcggtggatacaaccattcaggccttcctgatctctgaaaaaacggagattccggtcatg
gtctgtgttgacggatatacactgacccatactctcgagccggtcgacctccctgatcag
ggacagatcgacacgttccttcccccgtttcattttcgacggacactggattcccaatct
cccattatggtcggaacgattgtttctccagacttttataccgaagcccgttatatcaat
catcaggattttgaaaaggccctcacagtcatcaaggagacagatgagatctattttcac
ctgaccggacgccgttcaggagcgctcctttctgtgaccggaaatagaaatggccgaact
ggcattctccttatgggatccgttttcggaacacttacggacgccctgtcttcccatgaa
ggaaaagaagacatccgccttttaaaactgcgctcttttcgcccgtttccccaaaaagag
cttcaggaagcggttcatggactcaggacattgattgttcttgatcgatccatctccccc
ggaggtggcgcagggattgtcggaatggaggtccgatcggccctttttggccaaaaagat
gctcccagaatcatcaatgccgttgtcggacttggaggaagagacttacccatgtccctt
ctccggcaactggtagacctttccaaaaaaactgatgctccggaatttctctttgcggat
ctggagccttcccggatcacccgggagctctctccactcaacagaacaaacacctccgaa
gaacgataa

DBGET integrated database retrieval system