KEGG   Leptospirillum ferrooxidans: LFE_0044Help
Entry
LFE_0044          CDS       T01809                                 

Definition
(GenBank) putative pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFE_0044
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_0044
   00020 Citrate cycle (TCA cycle)
    LFE_0044
   00620 Pyruvate metabolism
    LFE_0044
   00640 Propanoate metabolism
    LFE_0044
   00650 Butanoate metabolism
    LFE_0044
  Energy metabolism
   00680 Methane metabolism
    LFE_0044
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFE_0044
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFE_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(51490..52104)
Genome map
AA seq 204 aa AA seqDB search
MVEIRIHGRGGQGSVSAAYLLALAAFESGLYAQAFPSFGAERRGAPISAFVRIHETPFAR
HCQVLSPDYLIILDESLIFLPETLSGLATSGGIFVNSRKSRPEIQKQFLERGLSFQEDSR
MELVGATEISLAHLGKSIPNTVLVSAFLSLTQIISQSSLEKALAKRFNGPVLDANMKMVR
EGSNQVKEGSWMDSHPETRRQAHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatccggatacatggaaggggagggcaaggaagcgtttcagcggcctatctt
ctcgcgttggccgcttttgaaagcggactttatgcccaggcttttcccagctttggtgca
gaaagacgtggggcgccgatcagtgcctttgtccggatccatgaaaccccatttgcccgc
cattgtcaggttctttcccctgattatctcatcattctcgatgaatccctgatttttctt
cccgaaaccctgagcggactggccacttccggagggattttcgtcaactccagaaaatca
cgtcctgaaattcaaaaacaatttttggaaagaggactctcctttcaggaagactccaga
atggagcttgttggagcaacggagatctcactcgctcatctcggaaaatccattcccaac
accgttcttgtttcagcctttctttccctcacacagatcatttcgcaatcctctctcgag
aaggctcttgccaaaagattcaacggaccggttcttgacgccaacatgaagatggtccgg
gagggatcaaaccaggtcaaggaaggctcatggatggattcacaccctgaaaccagacgc
caagcccatgcttga

DBGET integrated database retrieval system