KEGG   Leptospirillum ferrooxidans: LFE_0046Help
Entry
LFE_0046          CDS       T01809                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFE_0046
   01230 Biosynthesis of amino acids
    LFE_0046
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_0046
   00051 Fructose and mannose metabolism
    LFE_0046
   00562 Inositol phosphate metabolism
    LFE_0046
Enzymes [BR:lfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LFE_0046
Exosome [BR:lfc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LFE_0046
  Exosomal proteins of bladder cancer cells
   LFE_0046
  Exosomal proteins of melanoma cells
   LFE_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(53229..54026)
Genome map
AA seq 265 aa AA seqDB search
MLLVANWKMNMTRAQINDYLDVLSASPIWPALEEAGIEIALAPSSVYLDHLVRSIREKEL
PIRVVAQDVSTRTSGAFTGEIGVPNLLDIGVSGVILGHSERRRFFGETDEDVCDKTDLCL
RAGLMPIICFGESSADRKSGRAFDVIKTQLQPVADRANLLREDGVYTALFLAYEPIWAIG
SGIVAGATDVCEVTAFGFDGFTWPERPKFLYGGSITSDNIVEISACDKLSGFLVGSSWLD
PKSLLHSAQKIASVIKEGSLSKRAH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttgtcgcaaactggaaaatgaacatgactcgggcccagatcaacgactacctt
gatgtcctgtcagcttcccctatctggccggcactggaagaagcggggatcgaaatcgcc
ctcgctccttccagcgtctacctcgatcatcttgtcaggtcgatccgggaaaaagaactc
cctatccgggttgtagcacaggacgtctcaacaagaacgtccggtgcctttacaggggag
atcggcgttcccaatcttctggatatcggagtcagcggggtcatactgggacattcagag
cgcagacggttttttggagaaaccgatgaggatgtttgcgacaagacagacctctgtctg
agggccggtctgatgccaatcatctgttttggagaatccagcgcagacagaaaatccgga
agggcattcgatgtcatcaaaacccagttgcaaccggttgccgacagggcgaacctgctt
cgtgaagatggcgtctatacagcccttttcctcgcctatgaaccgatctgggccattggc
tccggtatcgttgccggagcgacagatgtctgtgaagtcaccgcattcggatttgatggg
ttcacttggccagaacgacccaagtttctttatggaggatccattacctcagacaatatt
gttgaaatatccgcctgtgacaaattatccggattcctcgtgggaagttcctggctggat
ccaaaatcacttctgcattctgcccagaaaatcgcttctgtcatcaaggaaggctccctg
agcaagagagcacactga

DBGET integrated database retrieval system