KEGG   Leptospirillum ferrooxidans: LFE_0046Help
Entry
LFE_0046          CDS       T01809                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFE_0046
   01230 Biosynthesis of amino acids
    LFE_0046
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_0046
   00051 Fructose and mannose metabolism
    LFE_0046
   00562 Inositol phosphate metabolism
    LFE_0046
Enzymes [BR:lfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LFE_0046
Exosome [BR:lfc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LFE_0046
  Exosomal proteins of bladder cancer cells
   LFE_0046
  Exosomal proteins of melanoma cells
   LFE_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(53229..54026)
Genome map
AA seq 265 aa AA seqDB search
MLLVANWKMNMTRAQINDYLDVLSASPIWPALEEAGIEIALAPSSVYLDHLVRSIREKEL
PIRVVAQDVSTRTSGAFTGEIGVPNLLDIGVSGVILGHSERRRFFGETDEDVCDKTDLCL
RAGLMPIICFGESSADRKSGRAFDVIKTQLQPVADRANLLREDGVYTALFLAYEPIWAIG
SGIVAGATDVCEVTAFGFDGFTWPERPKFLYGGSITSDNIVEISACDKLSGFLVGSSWLD
PKSLLHSAQKIASVIKEGSLSKRAH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttgtcgcaaactggaaaatgaacatgactcgggcccagatcaacgactacctt
gatgtcctgtcagcttcccctatctggccggcactggaagaagcggggatcgaaatcgcc
ctcgctccttccagcgtctacctcgatcatcttgtcaggtcgatccgggaaaaagaactc
cctatccgggttgtagcacaggacgtctcaacaagaacgtccggtgcctttacaggggag
atcggcgttcccaatcttctggatatcggagtcagcggggtcatactgggacattcagag
cgcagacggttttttggagaaaccgatgaggatgtttgcgacaagacagacctctgtctg
agggccggtctgatgccaatcatctgttttggagaatccagcgcagacagaaaatccgga
agggcattcgatgtcatcaaaacccagttgcaaccggttgccgacagggcgaacctgctt
cgtgaagatggcgtctatacagcccttttcctcgcctatgaaccgatctgggccattggc
tccggtatcgttgccggagcgacagatgtctgtgaagtcaccgcattcggatttgatggg
ttcacttggccagaacgacccaagtttctttatggaggatccattacctcagacaatatt
gttgaaatatccgcctgtgacaaattatccggattcctcgtgggaagttcctggctggat
ccaaaatcacttctgcattctgcccagaaaatcgcttctgtcatcaaggaaggctccctg
agcaagagagcacactga

DBGET integrated database retrieval system