KEGG   Leptospirillum ferrooxidans: LFE_0193Help
Entry
LFE_0193          CDS       T01809                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LFE_0193 (galU)
   00052 Galactose metabolism
    LFE_0193 (galU)
   00500 Starch and sucrose metabolism
    LFE_0193 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LFE_0193 (galU)
Enzymes [BR:lfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LFE_0193 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191152..192033
Genome map
AA seq 293 aa AA seqDB search
MKVDIRKALFPLAGHGTRFLPMTKASPKEMLPLVDKPVVQYVVEEVVAAGVSEVIMITGR
GKRAIEDHFDISYELEDMLRKKGKFELLEEVRKISFLADFSYTRQKESKGLGHAVFCGRQ
LIGDEPFAVVLGDEVIDSDEPALSQLVRAYKRYQGPVLGVQRVPKSDVSSYGIAAGRLIE
PGLFEVTSLVEKPKPEDAPSDYAVIGRYILTPDIFDILENQEPGVGGEIQLTDALRTLSS
HRAIYAIEVSGNRYDTGDKMGFLKASVQFGLKNPDLGPQFREYLDQLLGSYKT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgacattcgaaaagctctttttccgcttgctggccacggaacccgattcttg
cccatgacaaaagcttcgccaaaagagatgcttccattggtggacaagcccgttgtccaa
tatgtagtggaggaagttgtcgcggcgggtgtgagcgaggtcatcatgatcactggtcgg
ggaaaaagagcgatcgaggatcactttgacatctcctatgagcttgaggacatgctcaga
aagaaggggaagtttgagctgctcgaagaagtccgtaagatctcctttctggccgacttt
tcttataccaggcagaaagaatccaagggcttggggcatgctgtcttttgtggccgacaa
ctgattggagatgagcctttcgctgtagttctgggcgatgaggtcattgactcggatgag
ccggccctttctcaactggtccgggcatacaagcgatatcagggccctgttctgggcgtt
cagagggttcccaaaagtgatgtcagttcttacggaattgctgctgggcgattgattgaa
ccaggactttttgaggtaacttcccttgtggaaaaaccaaaacctgaggatgctccctct
gattacgctgttattgggcgttacattttgaccccggatatttttgatatcctcgagaat
caggaaccaggggtgggtggtgaaattcagctgacagatgcacttcggaccctttcaagt
catcgtgcgatctacgcaattgaggtttcgggaaatcggtatgatactggagacaaaatg
gggtttttgaaagcttctgtccagtttggtctgaaaaatcctgatttgggacctcaattt
cgggaatatctggaccaattgctcggctcatataaaacctga

DBGET integrated database retrieval system