KEGG   Leptospirillum ferrooxidans: LFE_0385Help
Entry
LFE_0385          CDS       T01809                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lfc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(378472..379101)
Genome map
AA seq 209 aa AA seqDB search
MISRLFGTIISWEEDAITLRAGAVGYRVHLSPYSMSVLSGTDSESSELSLYTQFFWSEHQ
DSPTLVGFPTKEEQDLFLLLRKVQGLGPMTALRILSLPVEEMLSMISQGDVSRLKTLKGV
GDKTAKKIISELKEEVQPISTPLIPAEPTGKNKTASLTDISSLVRETLVQQFGHTPIEAS
RLVAAALKKNPDIRTIEELFSEVYRIGSD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagattgttcggaacaatcatctcctgggaagaagatgccattacccttcgc
gcgggagctgtcgggtatcgggtccacctatcgccctactcgatgagtgtcctgtcggga
accgattcagaatcttccgagttaagcctgtatacccagttcttctggagcgaacatcag
gattctccaacccttgttgggtttcccacaaaagaagaacaggacctttttcttcttctc
agaaaggttcagggacttggccccatgaccgcactgcgaattctttcccttcctgtcgag
gagatgctttccatgatctcgcagggagatgtctcccgattgaaaacactcaagggagtc
ggagacaaaaccgctaaaaaaatcatttccgagctgaaggaagaagtccagcccatatca
acacccctgattccggccgaacccaccgggaagaacaaaacagcttcgctgacagatatt
tcatccctggtcagggagacattggtccaacaattcggacacactccgatcgaagcatca
agacttgtcgccgcagctctcaagaagaaccccgacattcgtaccattgaagagcttttc
tcggaggtttacagaattggatctgactga

DBGET integrated database retrieval system