KEGG   Leptospirillum ferrooxidans: LFE_0686Help
Entry
LFE_0686          CDS       T01809                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LFE_0686
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LFE_0686
Enzymes [BR:lfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LFE_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662558..663157
Genome map
AA seq 199 aa AA seqDB search
MDYDPVAIALEYAESGASGISVLTDPRFFGGSLPDLLAVKSAFLSRGIVLPVLRKDFIID
PRQVDEAFLFGADMILLIVRILADKTLVKLIEQARELGMEALVEVHSETEMKRALDAGCS
FLGVNHRDLDTLQMDLDLSSRLAGMIPDHVIRIAESGLKTGRDCLRMAELGYDGVLVGES
FLTTAHPGLALKDFLTYVD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggactatgatccggttgcgattgctttggagtatgctgaatccggagcatccggaata
tccgttctgacagatccccgctttttcggggggagcctccccgatctccttgctgtcaaa
tccgcttttttatctcggggtattgttttgccggtcttgaggaaggattttatcattgat
ccaagacaggtggatgaggcgtttctgtttggggccgatatgatcttgctcattgtccgg
atacttgccgacaagactcttgtaaagctgattgaacaggcaagggagttgggaatggaa
gcgcttgttgaggttcattcggagacggagatgaaaagagccctggatgcaggctgctct
tttcttggcgtcaatcatcgtgatcttgatacattacagatggatcttgacctttcaagc
cggcttgccggaatgattcccgatcatgttatccggattgccgagagcggcctgaaaacc
ggtcgggattgcctgagaatggcagaacttggttacgatggcgttctggtaggggagtct
tttttgacgacagctcatcctggtttggctcttaaggatttcttgacgtatgtggattaa

DBGET integrated database retrieval system