KEGG   Leptospirillum ferrooxidans: LFE_0688Help
Entry
LFE_0688          CDS       T01809                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LFE_0688
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFE_0688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LFE_0688
Enzymes [BR:lfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LFE_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663786..665006
Genome map
AA seq 406 aa AA seqDB search
MKDLKKVLKPSRMPDHSGYFGEFGGRFVSETLMEALYELETAFKKAWSDRVFRKEYQDVL
TEFVGRPSPLTFAEGLTNHAGGARIYLKREDLNHTGAHKINNAVGQALLAKRMGKKRLIA
ETGAGQHGVATATVAAKYGFDCEIFMGSEDARRQSLNVFRMNLLGAKVKEVDGGTKTLKD
AISEALRDWAQSVLTTHYVLGTAFGPHPFPLMVRSFQSIIGREARQQIMKKEGRLPDALV
ACVGGGSNSLGLFHHFIGDASVQMFGIEAGGRSLSEGDHAARFQGGRVGVLQGSKTFVLQ
NPDGQILRTHSVSAGLDYSAVGPELAYYFETGRVHFDAVGDDEALQAFDTLSRLEGIIPA
LESSHAIAYGIRLAREMGRGKILIINLSGRGDKDVLEVARLRGEIS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatctgaagaaggtgctcaaaccttctcgaatgccagatcattccggatatttt
ggggaatttggcggacgatttgtttcggaaacactgatggaagctctgtatgaacttgaa
acagcttttaaaaaagcttggagtgaccgtgtattccggaaagagtaccaggatgttctt
acggaatttgtcggtaggccgtctcccctgacttttgccgaaggattgaccaaccatgca
ggtggtgctcgaatctatctcaaaagggaggatctcaaccatactggtgcgcacaagatc
aataatgctgtaggtcaggcccttcttgcgaaaagaatgggaaaaaaaaggcttattgct
gaaacaggtgctggccagcatggtgtcgccacggcaactgtggcggcaaagtatggcttt
gattgtgaaattttcatggggtctgaagatgcaaggcgtcaatccctgaacgttttccgg
atgaaccttcttggtgcaaaagtaaaagaagtcgatggcgggacgaagacgctcaaggat
gcaatcagtgaggctttgagggattgggcccagtctgtcctgacaacccattacgtcctg
gggactgcgtttggaccgcatccttttcccttgatggttcgctcgttccagtctattatc
gggcgtgaggcacgccagcaaatcatgaaaaaggaagggcgtctgccggatgcactggtg
gcttgtgtgggaggcggaagcaattctctcggcttgttccatcattttattggcgatgca
tctgttcagatgttcggaatcgaagcgggaggccgctcattgtctgaaggtgatcatgcc
gcacgttttcaaggcgggagagttggtgttctacagggttccaagacatttgtcctgcag
aacccggatggtcagatcctgagaacgcattccgtttccgcgggtcttgattactcagcg
gtaggacctgaattggcctattattttgaaacgggacgcgttcactttgatgcggttggg
gatgatgaagccttgcaggcatttgataccctttctcgtctggaggggattataccggcg
ctggaaagttcccatgcgatcgcttacggtattcgattggccagggaaatggggcgtggg
aagatcctgatcatcaatctttccggccgtggagataaagatgttttggaggtggctcgt
ttgcggggggaaatttcatga

DBGET integrated database retrieval system