KEGG   Leptospirillum ferrooxidans: LFE_0689Help
Entry
LFE_0689          CDS       T01809                                 

Definition
(GenBank) putative tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LFE_0689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFE_0689
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LFE_0689
Enzymes [BR:lfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LFE_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
665003..665794
Genome map
AA seq 263 aa AA seqDB search
MMPRTLKKVRLSDKKVIPYLMAGDPDLPVTKRLLSEASKAGVWAVELGIPFSDPTADGPV
IQKAAIRALSDKTSLTKILSFLGEIPLSERPPIFIMTYFNLFLSLTIEEFIQEAGRVGGI
VGAVIPDLSFEDSKKVRKAFKAAGLALIPFISPTTSPSRIKKILATADGFIYFVSLLGTT
GKALTLSSTMEESVRNLRSQTKLPVCVGFGIQTPEMAKEILQFSDGVIVGSRLVQEEKDP
LEWGKLLRQFCEVARSMPSSQHQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgccccggacccttaaaaaagtgagactctctgataaaaaagtcatcccatatctt
atggcgggagatccggatctcccggtgaccaagcgacttctctctgaagcgagcaaggca
ggtgtatgggctgttgaattgggaattcccttctctgacccgacggcagatggtccagtt
atccagaaggcggccatcagggccctatcggataaaacatcccttaccaaaattctctct
tttctgggagagattccgctttctgaaagacctcctatttttatcatgacctacttcaat
ctctttttgtcattgacgattgaggagtttatccaggaggccggtcgagttggcggtatc
gtcggggcagtgataccggatctgtcttttgaagactcaaagaaggtcaggaaagctttt
aaagcggcgggtttggctctcatcccgtttatatcaccgacgacaagcccgtcccgtata
aaaaaaattcttgcaacagcggatggattcatttactttgtatctttgctgggtacgact
ggaaaagcgctgaccttgtcgtcgacaatggaagagtcggtgaggaatcttcgttctcag
acgaaattgcctgtttgtgtcggttttggaattcagactccggaaatggcaaaagagatt
ctccagttttctgacggagtgattgttgggtccagattggttcaggaagaaaaggatccg
cttgagtggggaaaattgttgcgacaattttgcgaagtggccagatcgatgccttcttcg
caacatcaatag

DBGET integrated database retrieval system