KEGG   Leptospirillum ferrooxidans: LFE_0689Help
Entry
LFE_0689          CDS       T01809                                 

Definition
tryptophan synthase, alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LFE_0689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFE_0689
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LFE_0689
Enzymes [BR:lfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LFE_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
665003..665794
Genome map
AA seq 263 aa AA seqDB search
MMPRTLKKVRLSDKKVIPYLMAGDPDLPVTKRLLSEASKAGVWAVELGIPFSDPTADGPV
IQKAAIRALSDKTSLTKILSFLGEIPLSERPPIFIMTYFNLFLSLTIEEFIQEAGRVGGI
VGAVIPDLSFEDSKKVRKAFKAAGLALIPFISPTTSPSRIKKILATADGFIYFVSLLGTT
GKALTLSSTMEESVRNLRSQTKLPVCVGFGIQTPEMAKEILQFSDGVIVGSRLVQEEKDP
LEWGKLLRQFCEVARSMPSSQHQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgccccggacccttaaaaaagtgagactctctgataaaaaagtcatcccatatctt
atggcgggagatccggatctcccggtgaccaagcgacttctctctgaagcgagcaaggca
ggtgtatgggctgttgaattgggaattcccttctctgacccgacggcagatggtccagtt
atccagaaggcggccatcagggccctatcggataaaacatcccttaccaaaattctctct
tttctgggagagattccgctttctgaaagacctcctatttttatcatgacctacttcaat
ctctttttgtcattgacgattgaggagtttatccaggaggccggtcgagttggcggtatc
gtcggggcagtgataccggatctgtcttttgaagactcaaagaaggtcaggaaagctttt
aaagcggcgggtttggctctcatcccgtttatatcaccgacgacaagcccgtcccgtata
aaaaaaattcttgcaacagcggatggattcatttactttgtatctttgctgggtacgact
ggaaaagcgctgaccttgtcgtcgacaatggaagagtcggtgaggaatcttcgttctcag
acgaaattgcctgtttgtgtcggttttggaattcagactccggaaatggcaaaagagatt
ctccagttttctgacggagtgattgttgggtccagattggttcaggaagaaaaggatccg
cttgagtggggaaaattgttgcgacaattttgcgaagtggccagatcgatgccttcttcg
caacatcaatag

DBGET integrated database retrieval system