KEGG   Leptospirillum ferrooxidans: LFE_0717Help
Entry
LFE_0717          CDS       T01809                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LFE_0717
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LFE_0717
Enzymes [BR:lfc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LFE_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691544..692515
Genome map
AA seq 323 aa AA seqDB search
MNLFLPAHTLEKKHLLSISDLSVPEIEGIFQTADSFLDLSSRSVRKVPSLRGRIIVNLFY
EASTRTRTSFEIAGKRLSADVINITTTQSSVVKGESLLDTVRTIEALGADGIVIRHSSSG
VPQWIAKQVGCHVINAGDGLREHPTQALLDLFTIQKRKKNLSGLTVAIVGDVLHSRVARS
NMIAMQMMGMKVRVVGPPTLIPREVQKWGVEVFHNLREGLEKADVIMLLRLQLERQASGY
IPSIEEYSRLFGLSPEKLSWANPDAIVLHPGPVNRGIEIQGEELFSDRSAILDQVHHGVA
IRMAILYLLMAGGRPEEENRAPA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttcttaccagcccatactcttgaaaaaaaacatctattatccatttcggat
ctgtctgttcctgagatcgaaggaattttccagacggcggattcttttctggacctttct
tcaagatccgtccgaaaggttccctctcttcgggggaggattatcgtcaacttgttttac
gaggcatcaacgagaacccggacatcctttgaaatcgccggaaaaaggctttctgctgac
gtcatcaacataacgacaacccagtcgagcgtggttaagggtgaaagtcttctggatacc
gtgcggaccatagaagctttgggcgctgatggtattgtcatccgtcattcttcatcaggt
gtcccccagtggattgcaaaacaagtcggttgccatgtgattaatgccggggatggcttg
cgggaacatccgacacaggctcttctggatctttttacaatccagaaaagaaaaaagaat
ttgtcgggattgaccgttgcgattgtgggggatgtccttcatagcagggttgcccgttca
aatatgattgccatgcagatgatggggatgaaggtcagggttgtgggaccaccaacactg
atacccagagaagttcaaaaatggggcgttgaagtttttcataatctgcgggaaggcttg
gagaaagccgatgtcatcatgcttctgaggcttcaacttgagcgacaggcatccggctac
atcccttccattgaggagtattcccggctgtttggcctatctccggaaaaactctcctgg
gcaaacccggatgcgattgtcttgcatccggggcctgtcaacagggggatcgagatacaa
ggggaagagctgttttcagaccgttcagctattttggatcaggttcatcacggcgtggct
atcagaatggccatcctttaccttttaatggccgggggacgacccgaggaggaaaatcgt
gcaccagcgtga

DBGET integrated database retrieval system