KEGG   Leptospirillum ferrooxidans: LFE_0824Help
Entry
LFE_0824          CDS       T01809                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lfc  Leptospirillum ferrooxidans
Brite
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LFE_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812234..813238
Genome map
AA seq 334 aa AA seqDB search
MHNHDRFQMKVFSFASFLASFLVFPISSWAGALVPLPPNPDIPSANLQSAQKISLGKELF
FDPRLSANGKISCASCHVPSKGYADPRAVSIGVGGKHGTRNAPSALNAAYFSRQFWDGRA
GSLEEQGIGPLTNPVEMANPSNQSVVRRLQKESRYRRSFEAVFGGQVSIDRIAKAIAAYE
RTLVTPMSAYDQFLMGNKTALTPQEQHGFALFKGKGRCVLCHNGALLSDQEYHNLGVAGS
KDVGRYAVSHDPIDKGRFRTPGLRNVALTAPYMHDGSVKTLMDVVEFYNQGGGKNPYPKD
ALLIPLHLTKSDERDLVAFLNALTGETKHEMSMK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcataatcatgatcgttttcaaatgaaagttttttcatttgcttcatttcttgcctca
tttctcgtttttccgatctcttcatgggcgggtgccttggtgccccttccacctaatccg
gatattccatcagcgaatttgcaaagtgcgcaaaagatttctcttggaaaggagttgttt
tttgatcccaggctatctgctaatggaaagatcagttgcgcgtcctgccatgttccttca
aaaggttatgcagatcccagagctgtttcgattggggttggtggtaaacatgggacgaga
aatgccccatcagccttgaatgccgcttatttctctcgtcagttttgggatggtcgagcc
ggaagcctcgaagagcaggggattggccccctgacaaatcctgtagagatggctaacccc
tcaaaccagagtgttgtgcgtcgccttcagaaggagtcacgataccgccgttcttttgaa
gctgtgtttggaggtcaagtctccattgaccggatcgcaaaggctattgcagcctatgag
agaactttggtaacaccaatgtcagcctatgatcagtttctgatggggaacaaaaccgcc
ttgacgccacaggaacaacatggttttgctctttttaagggtaagggaaggtgtgttttg
tgtcacaatggtgcattgcttagcgatcaggaatatcataatcttggtgtggcggggtca
aaagatgtgggacggtatgccgtttctcatgatccgattgacaaggggcgcttcagaact
cccggactcaggaatgttgccctaacggctccctacatgcatgatgggtctgtgaaaacc
ttgatggatgttgttgagttctataatcagggtggagggaaaaatccctatcccaaagat
gccctccttattcctctccatctgaccaagtcggacgagcgggatcttgttgctttttta
aatgccctgacaggtgagacgaagcatgaaatgtccatgaaataa

DBGET integrated database retrieval system