KEGG   Leptospirillum ferrooxidans: LFE_0826Help
Entry
LFE_0826          CDS       T01809                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lfc00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
814039..814578
Genome map
AA seq 179 aa AA seqDB search
MATISTTSGYATDDTVAINRYLESIEVFFSNWPIPAAMEASKLRKTPSLDELEKKNLLEG
FEEIFLRLQKEMGMKSRDLIVLHPGTPGLSEMLDRFSPCHTHDDEEVRYIIDGEGEFGFV
LPTGEQALLKIGPGDFIRIPKNTEHWFVLTEKRCIKAIRYFSDTAGWVPKYTSTKVKIS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttggctaccatttcaacaacatctggttatgcgactgacgatacggttgccataaatcgt
tatcttgaatccattgaggttttcttttcaaattggccaattcctgctgcaatggaagca
tcgaagttgcgaaaaacgccctccttggatgaattggaaaaaaagaacctccttgaaggc
tttgaggagatatttctccgtctccaaaaagagatgggcatgaaaagtcgggacttgatc
gttctacatccaggaaccccaggactttctgaaatgttggaccgattttctccgtgccat
acgcatgatgatgaagaggtgcgctatatcattgatggcgagggagaatttggttttgtt
ctgccaacaggtgaacaggccctattgaagattggaccaggagactttattcgtatacca
aaaaatacagagcactggtttgtcctgacagaaaaacgttgtattaaggcgatccgttat
ttttcagataccgctggatgggtgcccaaatatacttcaacaaaggtaaagatctcttga

DBGET integrated database retrieval system