KEGG   Leptospirillum ferrooxidans: LFE_0846Help
Entry
LFE_0846          CDS       T01809                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LFE_0846
Enzymes [BR:lfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LFE_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837820..838614
Genome map
AA seq 264 aa AA seqDB search
MVMISCFDRLHLQMESHTAEESSSAITLQLKGRVIDGDPGSNLIVRAAQMVLNRYALKSI
PRISIMLEKNIPVGAGLGGGSSDAAGTLFAVNRLLGSQLSLSELSEMASELGSDVPFFLG
NSHALCWGRGEKIIPLSPMEPKIIVLWNPGFSLSTGLVYQSLHASESEELTESAAISKIE
GLLREDECVNDLESVAFNLHPILFTVKESLYEFGAKKAMLSGSGPTLFGIYSDRAQAEKA
SRHLQEKFGGWSDVFETLEVSPLF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgatctcatgctttgatcgactgcatttgcaaatggagagccatacagccgaa
gaatcctcaagtgctatcactttgcagttaaagggcagggtgattgatggggatccaggc
tcaaacctgattgttcgtgcagctcagatggttttgaatcggtatgccctcaagagtatt
cccagaatatcaatcatgctggagaaaaatattccagttggggccgggcttggcggtgga
tcctctgatgctgccggaactttatttgctgttaaccgcttgttaggctcacaactttcc
ttgtcggaattgtctgaaatggcaagtgaattaggaagtgatgttccattttttttaggg
aattctcatgcgttatgctgggggagaggagagaaaatcatccctctgtcaccaatggag
cctaaaattatcgttctttggaacccaggcttctctttatcaacgggacttgtataccaa
agtcttcatgccagcgagtctgaagagttgacagaatcagctgcaatctctaagattgaa
ggtcttttgcgggaggatgaatgtgtgaatgaccttgagtcagtcgcgtttaacctccac
ccgattctttttactgttaaagagagtctttatgaatttggggcaaagaaagcaatgcta
agcggttcgggcccaacgttatttgggatttactccgatagggcccaagcagaaaaggcg
tccagacatcttcaggaaaaatttggtgggtggtctgatgtgtttgaaaccctggaggtg
tcgccactgttttga

DBGET integrated database retrieval system