KEGG   Leptospirillum ferrooxidans: LFE_1034Help
Entry
LFE_1034          CDS       T01809                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LFE_1034
Enzymes [BR:lfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LFE_1034
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     LFE_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1033822..1035489
Genome map
AA seq 555 aa AA seqDB search
MDEPVNPILHGVMYEIYIRSYSDHSGDGTGDFLGIVDRLDYISRLGVSSILLNCPFLSVH
GKDHHPLLDWMKLDHELGTLSDFLLLLEKAHMKGLKVLLSLPVNATSDQHVWFSESRLSR
GSLFSNSYFWSDTPPPEPETRHDPPEKINWTLDADSGRYYWFGDHKDEPSLNYGDAEVLS
EMCRIFEHWFALEVDGFRLAGAGRLHSWKKNEIIPVQDPFQTFHPVIYPLKKSYPEKMFL
FETGSPPSKRGQVNDSRLFYHFNPFFPAVISAIKNEDRSPLEPILDGKPKGRSKKSLSRN
RTIHLRERSEETFELLDTLSSDDALFPLAPDLPEDRPILSRVARLMENGRRRIQLVMSLF
LTFPGLPVLYYGDEIGMGDHPHLRGKNPIRTPMHWSADRNAGFSRADPEELFNPVIEDPL
YSYQMVNVESQERFPDSHLWNVRRMIEVRNQNPLLYGDGDFELIETRSASILAYVRSCDG
ATGLFIHNLSKSAMFGHLDLAKWHGYKPREMFSGGAFPTVGKAPYLITMTPYSTIWFLLE
APIRKKMAKSRRRGS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtggacgagccggttaatcccatattgcacggtgtgatgtacgagatttacatcaggagc
tattcggaccattccggagacgggaccggcgattttctgggtatcgtggaccgactggat
tatatttccagactgggtgtcagttcgattcttctcaattgtccttttctgtctgttcac
ggaaaagatcatcatcccctgctggactggatgaaactggatcatgagctgggcaccctc
tcagactttttgcttcttcttgaaaaagctcacatgaaaggattgaaggtcctgctttct
cttccggtgaatgcgacgagtgaccagcatgtctggttttccgagtcccgattgtcccgg
ggatccctgttttcaaacagttacttctggtctgatacgccccctcccgagccagagacg
agacacgatcctccagaaaagatcaactggacccttgatgccgattccgggagatactat
tggtttggcgatcataaggacgagccttccctcaattatggtgatgcggaagtgctttcc
gaaatgtgtcgcatcttcgagcactggtttgcgcttgaggtggacggatttcgtcttgcc
ggagccggaaggcttcattcctggaaaaaaaatgaaatcattcccgtccaggatcctttt
caaacctttcatcctgtcatttacccgctcaaaaaatcctatccggaaaagatgttcctt
tttgaaaccggatctcctccctcaaaacgcgggcaggtaaatgattcaaggcttttctat
catttcaatccttttttccccgcggtgatctctgcgattaaaaacgaggaccggtcacca
cttgaaccgatccttgatgggaagcccaaaggacgctcgaaaaagagcctctccagaaac
aggacgatccacctgagagagcgttcggaagaaacctttgaattgctcgacacactgtca
agcgatgacgcgctctttccattggctccggatctcccggaggatcgcccgatcctgtcc
agggtggcacggctcatggaaaatggaagacgacgaatccagctggtgatgagtcttttt
ttaaccttccctggacttcctgtcctgtattacggggatgagatcggtatgggcgatcat
ccccacctcaggggaaaaaacccgatccgtaccccgatgcactggtcggctgaccggaat
gccggattttccagggcggatccggaagagctcttcaaccctgtgattgaagaccctctt
tacagctatcagatggtgaacgttgaaagtcaggaacgatttcctgattcccatctctgg
aatgtccgaagaatgattgaagttcggaatcagaatcctcttctttatggagacggggat
tttgagctgattgaaacaaggtcggcatcgatcctggcttatgtccgctcctgtgatggg
gcaaccggcctttttatccacaatctttcaaaatcggccatgtttggacatctggatttg
gcgaaatggcacggttacaagccacgggagatgttttcaggcggggcttttcccacggtg
gggaaagccccttacctgatcaccatgactccgtattcaaccatatggtttttactggag
gctccgatcagaaagaaaatggccaaaagtcggaggaggggatcttga

DBGET integrated database retrieval system