KEGG   Leptospirillum ferrooxidans: LFE_1132Help
Entry
LFE_1132          CDS       T01809                                 

Definition
(RefSeq) hypothetical protein
Organism
lfc  Leptospirillum ferrooxidans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144388..1144957
Genome map
AA seq 189 aa AA seqDB search
MKGNDSRGYRDNLVSELSRVFPKADPRLFSAILKHPRESLFPSIPMDVLYGKERVGGFAG
RPAPSVFEVSKILVESGVQRGDRVLLISPTDPYFLVILSELTLRISIFEENPGIAEELSI
VLSELGLPHVKVVQDPSQLESVSEGKKIIHVNFLQKEHLLSDVYRKIPSGMLFCYVLGNG
TTMERYGCF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcaatgactcgagaggatatcgtgacaatctggtctcggagctgtcccgggtt
tttccaaaagcggatccgagactcttctctgcgatcctgaaacaccccagggagtccctt
tttccgtccattccgatggacgtcctctatggtaaagaaagggtcggagggtttgccgga
aggcctgccccatcagttttcgaggtctcgaaaatccttgtggaatccggagtacaaaga
ggggacagggttctgctgatctctccgaccgacccatactttctggtgatcctgtcggag
ctgacactcaggatctccatctttgaagaaaatcctggaattgcggaagagctttcgatc
gttctatccgaacttgggcttccccatgtcaaggtggttcaggatccttcacagcttgag
agcgtttctgaaggaaaaaagatcatacatgtgaattttttgcaaaaggaacacttgttg
tccgatgtttaccggaagattccttccggcatgctgttttgttatgtattgggaaatgga
acgacaatggagagatacggatgtttttga

DBGET integrated database retrieval system