KEGG   Leptospirillum ferrooxidans: LFE_1132Help
Entry
LFE_1132          CDS       T01809                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lfc  Leptospirillum ferrooxidans
Brite
Enzymes [BR:lfc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LFE_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144388..1144957
Genome map
AA seq 189 aa AA seqDB search
MKGNDSRGYRDNLVSELSRVFPKADPRLFSAILKHPRESLFPSIPMDVLYGKERVGGFAG
RPAPSVFEVSKILVESGVQRGDRVLLISPTDPYFLVILSELTLRISIFEENPGIAEELSI
VLSELGLPHVKVVQDPSQLESVSEGKKIIHVNFLQKEHLLSDVYRKIPSGMLFCYVLGNG
TTMERYGCF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcaatgactcgagaggatatcgtgacaatctggtctcggagctgtcccgggtt
tttccaaaagcggatccgagactcttctctgcgatcctgaaacaccccagggagtccctt
tttccgtccattccgatggacgtcctctatggtaaagaaagggtcggagggtttgccgga
aggcctgccccatcagttttcgaggtctcgaaaatccttgtggaatccggagtacaaaga
ggggacagggttctgctgatctctccgaccgacccatactttctggtgatcctgtcggag
ctgacactcaggatctccatctttgaagaaaatcctggaattgcggaagagctttcgatc
gttctatccgaacttgggcttccccatgtcaaggtggttcaggatccttcacagcttgag
agcgtttctgaaggaaaaaagatcatacatgtgaattttttgcaaaaggaacacttgttg
tccgatgtttaccggaagattccttccggcatgctgttttgttatgtattgggaaatgga
acgacaatggagagatacggatgtttttga

DBGET integrated database retrieval system