KEGG   Leptospirillum ferrooxidans: LFE_1345Help
Entry
LFE_1345          CDS       T01809                                 

Definition
(GenBank) putative dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00521  Streptomycin biosynthesis
lfc00523  Polyketide sugar unit biosynthesis
lfc01130  Biosynthesis of antibiotics
Module
lfc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LFE_1345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LFE_1345
Enzymes [BR:lfc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LFE_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: BAM07028
UniProt: I0IP29
Position
complement(1352151..1352699)
Genome map
AA seq 182 aa AA seqDB search
MKIEEQELSGILLITPNVFGDQRGSFFESWNQKAFKEANLDFTFLQDNHSRSQKGVLRGL
HYQIQQPQGKLVRVAYGSIFDVAVDLRRSSSNFGKWFGVVLSDENNQMLWIPPGFAHGFY
VLSERVDFLYKTTNFYEPSLERCILWNDPDVDINWPFKDLSSPILSVKDKNGIHLKNAEI
YP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaagaacaagaattatctggtatacttttgattacgccaaacgtttttgga
gatcaaagaggttctttttttgaaagctggaaccaaaaagcttttaaggaagctaatctt
gattttactttccttcaagataatcatagccgatctcaaaaaggtgttcttcggggtttg
cattatcaaattcaacaaccccaaggtaagttggttcgagtagcttatggttctatattt
gatgttgcagttgatttaaggcgatcttcttctaattttggaaaatggttcggtgttgtt
ttatctgatgaaaacaatcaaatgctatggattcctcctggttttgctcacggtttctac
gtactctctgagagagtggactttttatacaaaacaacaaatttttatgagcctagttta
gaacgctgtattctctggaacgatcctgatgttgatattaactggccgttcaaagatctt
tcatcacctatattgtcagttaaagataaaaatggtatccacctcaaaaatgctgagatt
tatccatag

DBGET integrated database retrieval system