KEGG   Leptospirillum ferrooxidans: LFE_1649Help
Entry
LFE_1649          CDS       T01809                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_1649
   00030 Pentose phosphate pathway
    LFE_1649
   00051 Fructose and mannose metabolism
    LFE_1649
   00052 Galactose metabolism
    LFE_1649
   00500 Starch and sucrose metabolism
    LFE_1649
   00520 Amino sugar and nucleotide sugar metabolism
    LFE_1649
  Nucleotide metabolism
   00230 Purine metabolism
    LFE_1649
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LFE_1649
Enzymes [BR:lfc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LFE_1649
    5.4.2.8  phosphomannomutase
     LFE_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1662800..1664221
Genome map
AA seq 473 aa AA seqDB search
MLKNLPSRIFREYDIRGVAETELTDEIIDAIGTAYGQMVLECGGKTISIGRDVRVSSERI
LKSFSEAITRLGIHILDIGIVPTPLLYFSLFHLPVDGGVMITASHNPPQDNGLKLAIGQE
TIHGSRIMEIRERIERPSAPPSVEKKGLIRPVPVRNSYISEIRERTSPLPAFMGRPIRAV
IDCGNGTGGLVARDLYNALGVRTELLFERPDGNFPNHHPDPSVPENLETLIAEVIKQKAD
IGIAFDGDSDRIGVVTGKGEILYGDQLMVLFSEQVLKRNPGAMIISEVKASKVLYDEIAR
MGGKPLMWKAGHSVIKAKMKEEGAPLAGEMSGHIFFKDGYFGFDDALYAGVRILQFMVEK
QKSLSELLSGIPKTANTPELRMDCPDALKFKLVDTLKSLLRDSGSSFVDIDGVRVEYPDG
WGLVRASNTQPALVLRFEGPTVERRDEIRNNIESMLQKAKELMVGENPAINTF
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaccttccatcccgcatcttccgggaatacgatatccgaggtgtggcagaa
accgaattgacagacgaaatcatcgacgcgatcggaacggcctatgggcagatggtcctt
gagtgcggggggaaaacaatctccatcggtcgtgacgtcagggtaagctccgaaaggatc
ctgaaaagcttttcagaggccattacccgactgggaattcatatcctcgacattggcatc
gtcccgaccccgcttctctatttttcccttttccatcttccggttgatggaggcgtcatg
atcacggcaagccacaaccctccacaggataacggcctgaagcttgccatcggccaggag
acgattcatggatctcgcatcatggaaatcagggagagaatagaacgcccatcagcacca
ccttccgtcgaaaagaaaggtctcatccgcccggtacctgtcagaaatagctatatcagt
gaaatccgtgaaaggacatcccccttgccggccttcatgggaagacctattcgcgccgtt
atcgactgcggaaatggaacgggaggacttgttgcaagagatctgtacaacgctcttggt
gtcaggacagagctcctttttgaacggcccgacggaaacttccccaaccatcatcccgat
ccaagcgttccggaaaatcttgaaaccctgatagcggaggtcatcaaacaaaaagcggat
ataggcattgcttttgacggggattccgatcgtatcggggtcgttaccggaaaaggggag
attctctacggtgaccagttgatggtccttttctccgaacaagtcctcaaacgcaaccct
ggagcgatgatcatctcggaagtcaaggcatcgaaggtcctttatgatgagatcgcccga
atgggaggaaagccgctcatgtggaaagcgggacactccgtgatcaaggccaaaatgaag
gaagaaggagctccactcgcgggagagatgagcggacatattttcttcaaggatggctac
tttggctttgacgatgccttgtacgccggtgtccggattcttcagttcatggtggagaag
cagaaatcactaagcgagcttctgtccgggattcccaagacagcaaacactcctgaactt
cggatggattgtccggacgcactgaagttcaagctggtcgataccttgaaatctctgttg
agggattcaggctcttcttttgtggatattgatggagtcagggttgaataccccgatggc
tggggactggtcagggcgagtaacacccaacccgcactcgtgttaagattcgagggacca
accgtcgaaagaagagatgaaatccgaaacaacatcgaatccatgcttcaaaaagcaaaa
gagctcatggtgggagagaatccggccataaatacattttga

DBGET integrated database retrieval system